Chondromyces crocatus: CMC5_041170 Help Entry CMC5_041170       CDS       T04010                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ccro  Chondromyces crocatus Pathway ccro00998   Biosynthesis of various antibiotics ccro01100   Metabolic pathways ccro01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ccro00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CMC5_041170 (acpP)    00074 Mycolic acid biosynthesis     CMC5_041170 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CMC5_041170 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 Motif Other DBs NCBI-ProteinID:  AKT39964 UniProt:  A0A0K1EGI7 LinkDB All DBs Position 5502610..5502858 Genome browser AA seq 82 aa AA seqDB search MAEGRDITAEVKRIIKEQLDVDEKDIKPEATFIEDLGADSLGLVELVLAFEEAFEIDISD EDTEKIRTVQDAIDYIEQHTKK NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggcggaagggcgcgacatcacggccgaggtcaagcggatcatcaaggagcaactcgac gtcgacgagaaggacatcaagcctgaagcgacgttcatcgaggatctgggcgccgattcg ctgggcctggtcgagctggtgctagccttcgaggaagcgttcgagatcgacatctcggac gaagacacggagaagatccggacggtccaggacgccatcgactacatcgagcagcacacg aagaagtaa

DBGET integrated database retrieval system