Chondromyces crocatus: CMC5_074250 Help Entry CMC5_074250       CDS       T04010                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ccro  Chondromyces crocatus Pathway ccro00998   Biosynthesis of various antibiotics ccro01100   Metabolic pathways ccro01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ccro00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CMC5_074250 (acpP)    00074 Mycolic acid biosynthesis     CMC5_074250 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CMC5_074250 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AKT43194 UniProt:  A0A0K1EQV7 LinkDB All DBs Position complement(10055426..10055692) Genome browser AA seq 88 aa AA seqDB search MNDQEVRLQLKQLMVSELNLEGKTPDDIDDALPLFGEGLGLDSLDALQLAMSIEERFGVR IPEGDEARPIFASVNALVEHILKSKSSA NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgaatgaccaggaagtgcggctgcagctcaagcaactcatggtctcggagctgaacctg gaaggaaagacccccgacgacatcgacgatgctcttcccctgttcggggagggactcggg ctcgactctctcgatgccctgcagctcgcgatgtccatcgaggagcgcttcggagttcgt atccccgagggagacgaggctcgacccatcttcgcgtcggtgaacgccctcgtggagcac attttgaagtccaagtcttcggcctga

DBGET integrated database retrieval system