Chondromyces crocatus: CMC5_082680 Help Entry CMC5_082680       CDS       T04010                                  Name (GenBank) uncharacterized protein   KO K02503   histidine triad (HIT) family protein [EC:3.9.1.-] Organism ccro  Chondromyces crocatus Brite KEGG Orthology (KO) [BR:ccro00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03016 Transfer RNA biogenesis [BR:ccro03016]     CMC5_082680   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccro04147]     CMC5_082680 Transfer RNA biogenesis [BR:ccro03016]  Eukaryotic type   Aminoacyl-tRNA synthetases (AARSs)    AARS associated factors     CMC5_082680 Exosome [BR:ccro04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    CMC5_082680 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  HIT DcpS_C CDH GalP_UDP_tr_C Motif Other DBs NCBI-ProteinID:  AKT44030 UniProt:  A0A0K1ESW9 LinkDB All DBs Position 11109210..11109503 Genome browser AA seq 97 aa AA seqDB search MVLEDEDWLAFHDTNPQAPTHVLVIPKRHVAGLREAAPEDQALLGKLLLGAQQVAAATGI QETGFRTVINSGANAGQTVFHLHVHVIGGRAMGWPPG NT seq 294 nt NT seq  +upstreamnt  +downstreamnt gtggtgctggaggacgaggactggctggccttccatgacaccaacccgcaagcgcccacg catgtgctggtgatccccaagcggcatgtggcaggactgcgggaggcggcgcccgaggat caggccctgctcggcaagctgttgctcggcgcgcagcaggtggcagcggcaacgggcatt caggagaccggtttcaggactgtgatcaacagcggcgccaacgcggggcagacggtcttc catctgcacgtgcacgtcatcggtggccgcgcgatgggctggccccccggctga

DBGET integrated database retrieval system