Crocuta crocuta (spotted hyena): 144219642 Help Entry 144219642         CDS       T11532                                  Name (RefSeq) C-C motif chemokine 3-like   KO K05408   C-C motif chemokine 3 Organism ccru  Crocuta crocuta (spotted hyena) Pathway ccru04060   Cytokine-cytokine receptor interaction ccru04061   Viral protein interaction with cytokine and cytokine receptor ccru04062   Chemokine signaling pathway ccru04620   Toll-like receptor signaling pathway ccru05142   Chagas disease ccru05163   Human cytomegalovirus infection ccru05323   Rheumatoid arthritis ccru05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ccru00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     144219642    04061 Viral protein interaction with cytokine and cytokine receptor     144219642  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     144219642    04062 Chemokine signaling pathway     144219642  09160 Human Diseases   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     144219642   09174 Infectious disease: parasitic    05142 Chagas disease     144219642   09163 Immune disease    05323 Rheumatoid arthritis     144219642   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     144219642  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ccru04052]     144219642    00536 Glycosaminoglycan binding proteins [BR:ccru00536]     144219642 Cytokines and neuropeptides [BR:ccru04052]  Cytokines   Chemokines    144219642 Glycosaminoglycan binding proteins [BR:ccru00536]  Heparan sulfate / Heparin   Chemokines    144219642 SSDB OrthologParalogGFIT Motif Pfam:  IL8 CXCL16 DUF6211 Motif Other DBs NCBI-GeneID:  144219642 NCBI-ProteinID:  XP_077605818 LinkDB All DBs Position Unknown AA seq 93 aa AA seqDB search MEVPKAALAVLLLTAALCSQTWSSFFGADTPTSCCFIYISRQIPRKFVVDYYETSSQCSK PGVIFQTKRGREICADPREAWVQEYITNLELNA NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggaggtccccaaggctgccctggctgtcctgcttctcaccgcggcactctgttcccag acttggtcttccttttttggtgccgacacccccacctcctgctgcttcatctatatctcc cggcagattcctcgcaaatttgtggtcgactattatgagaccagcagccagtgctccaag cccggtgtcatcttccaaaccaaaagaggccgggagatctgtgctgacccccgggaggcc tgggtccaggaatacatcaccaacctggagctgaatgcctga

DBGET integrated database retrieval system