Crocuta crocuta (spotted hyena): 144220589 Help Entry 144220589         CDS       T11532                                  Symbol RAB5A Name (RefSeq) ras-related protein Rab-5A   KO K07887   Ras-related protein Rab-5A Organism ccru  Crocuta crocuta (spotted hyena) Pathway ccru04014   Ras signaling pathway ccru04137   Mitophagy - animal ccru04144   Endocytosis ccru04145   Phagosome ccru04148   Efferocytosis ccru04962   Vasopressin-regulated water reabsorption ccru05014   Amyotrophic lateral sclerosis ccru05022   Pathways of neurodegeneration - multiple diseases ccru05132   Salmonella infection ccru05146   Amoebiasis ccru05152   Tuberculosis Brite KEGG Orthology (KO) [BR:ccru00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     144220589 (RAB5A)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     144220589 (RAB5A)    04145 Phagosome     144220589 (RAB5A)    04137 Mitophagy - animal     144220589 (RAB5A)    04148 Efferocytosis     144220589 (RAB5A)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     144220589 (RAB5A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     144220589 (RAB5A)    05152 Tuberculosis     144220589 (RAB5A)   09174 Infectious disease: parasitic    05146 Amoebiasis     144220589 (RAB5A)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     144220589 (RAB5A)    05022 Pathways of neurodegeneration - multiple diseases     144220589 (RAB5A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ccru04131]     144220589 (RAB5A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccru04147]     144220589 (RAB5A)    04031 GTP-binding proteins [BR:ccru04031]     144220589 (RAB5A) Membrane trafficking [BR:ccru04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     144220589 (RAB5A)  Endosome - Lysosome transport     144220589 (RAB5A) Exosome [BR:ccru04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    144220589 (RAB5A)   Exosomal proteins of other body fluids (saliva and urine)    144220589 (RAB5A)   Exosomal proteins of colorectal cancer cells    144220589 (RAB5A)   Exosomal proteins of bladder cancer cells    144220589 (RAB5A) GTP-binding proteins [BR:ccru04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     144220589 (RAB5A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA MMR_HSR1 RsgA_GTPase AAA_16 MCR_beta BrnT_toxin Motif Other DBs NCBI-GeneID:  144220589 NCBI-ProteinID:  XP_077607020 LinkDB All DBs Position Unknown AA seq 215 aa AA seqDB search MANRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQ TVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQR QASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKK LPKNEPQNPGANSARGRGVDLTEPTQPTRSQCCSN NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atggctaatcgaggagcaacaagacccaacgggccaaatactggaaataaaatatgccag ttcaaactagtacttctgggagagtctgctgttggcaaatcaagcctagtgctacgtttt gtgaagggccagtttcatgaatttcaagagagtaccataggggctgcttttctaacccaa actgtgtgtcttgatgacacaacagtaaagtttgaaatatgggatacagctggtcaagaa cgataccatagcctagcaccaatgtactacagaggagcacaagcagccatagttgtatat gatatcacaaatgaggagtcctttgccagagccaaaaactgggttaaagaacttcagcgg caagccagtcctaacattgtaatagctttatcaggaaacaaggctgaccttgcaaataaa agagctgttgattttcaggaagcacagtcctatgcagatgacaacagtttattattcatg gagacatcagctaaaacatcaatgaatgtaaatgaaatattcatggcaatagctaaaaag ttgccaaagaatgaaccacagaatccaggagcaaattctgccagaggaagaggagtagac cttactgaacccacgcagccaaccaggagtcagtgttgtagtaactaa

DBGET integrated database retrieval system