Crocuta crocuta (spotted hyena): 144221339 Help Entry 144221339         CDS       T11532                                  Symbol RAB2A Name (RefSeq) ras-related protein Rab-2A   KO K07877   Ras-related protein Rab-2A Organism ccru  Crocuta crocuta (spotted hyena) Pathway ccru04152   AMPK signaling pathway Brite KEGG Orthology (KO) [BR:ccru00001]  09130 Environmental Information Processing   09132 Signal transduction    04152 AMPK signaling pathway     144221339 (RAB2A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ccru04131]     144221339 (RAB2A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccru04147]     144221339 (RAB2A)    04031 GTP-binding proteins [BR:ccru04031]     144221339 (RAB2A) Membrane trafficking [BR:ccru04131]  Endoplasmic reticulum (ER) - Golgi transport   Forward pathways    Rab GTPases     144221339 (RAB2A) Exosome [BR:ccru04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    144221339 (RAB2A)   Exosomal proteins of other body fluids (saliva and urine)    144221339 (RAB2A)   Exosomal proteins of colorectal cancer cells    144221339 (RAB2A) GTP-binding proteins [BR:ccru04031]  Small (monomeric) G-proteins   Rab Family    Rab2/4/14 [OT]     144221339 (RAB2A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA Motif Other DBs NCBI-GeneID:  144221339 NCBI-ProteinID:  XP_077607943 LinkDB All DBs Position Unknown AA seq 166 aa AA seqDB search MITIDGKQIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTTWLEDARQ HSNSNMVIMLIGNKSDLESRREVKKEEGEAFAREHGLIFMETSAKTASNVEEAFINTAKE IYEKIQEGVFDINNEANGIKIGPQHAATNATHAGNQGGQQAGGGCC NT seq 501 nt NT seq  +upstreamnt  +downstreamnt atgataactatcgacgggaaacagataaaacttcagatatgggatacggcagggcaggag tcctttcgttccatcacaaggtcatattacagaggtgcggcaggggctttactagtgtat gatattacaaggagagatacattcaaccacttgacaacctggttagaagatgcccgccag cattccaattccaacatggtcattatgcttattggaaacaaaagtgatttagaatctaga agagaagtaaaaaaagaagaaggtgaagcttttgcacgagaacatggacttatcttcatg gaaacttctgctaagactgcttccaatgtagaagaggcatttattaatacagcaaaagaa atttatgaaaaaatccaagaaggagtctttgacattaataatgaggcaaacggcattaag atcggccctcagcacgctgctactaatgccacacacgcaggcaatcagggaggacagcag gcgggaggcggctgctgctga

DBGET integrated database retrieval system