Crocuta crocuta (spotted hyena): 144223800 Help Entry 144223800         CDS       T11532                                  Symbol H3-3B Name (RefSeq) histone H3.3   KO K11253   histone H3 Organism ccru  Crocuta crocuta (spotted hyena) Pathway ccru04613   Neutrophil extracellular trap formation ccru05034   Alcoholism ccru05202   Transcriptional misregulation in cancer ccru05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:ccru00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     144223800 (H3-3B)  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     144223800 (H3-3B)   09163 Immune disease    05322 Systemic lupus erythematosus     144223800 (H3-3B)   09165 Substance dependence    05034 Alcoholism     144223800 (H3-3B)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ccru03036]     144223800 (H3-3B)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccru04147]     144223800 (H3-3B) Chromosome and associated proteins [BR:ccru03036]  Eukaryotic type   Nucleosome assembly factors    Histones     144223800 (H3-3B) Exosome [BR:ccru04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    144223800 (H3-3B) SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF TFIID-31kDa Motif Other DBs NCBI-GeneID:  144223800 NCBI-ProteinID:  XP_077610712 LinkDB All DBs Position Unknown AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggcccgaaccaagcagactgctcgtaaatctacgggtgggaaagcgccccgcaagcag ctggccactaaagccgccaggaaaagcgctccctctaccggcggggtgaaaaaacctcat cgctacaggcccgggaccgttgcccttcgagagatccgtcgttaccagaaatcgactgag ctgctgatccggaagctacctttccagcggctggtgagggagatcgcccaggatttcaaa accgatctgaggtttcagagtgccgccattggcgcgctgcaggaggccagtgaagcgtac ctggtgggtttatttgaagatactaatctgtgtgccatccacgctaagagagtcaccatc atgcccaaagacatccagttggctcgccggatacggggggagagagcttaa

DBGET integrated database retrieval system