Crocuta crocuta (spotted hyena): 144224773 Help Entry 144224773         CDS       T11532                                  Symbol H2AC25 Name (RefSeq) histone H2A type 3   KO K11251   histone H2A Organism ccru  Crocuta crocuta (spotted hyena) Pathway ccru03082   ATP-dependent chromatin remodeling ccru04217   Necroptosis ccru04613   Neutrophil extracellular trap formation ccru05034   Alcoholism ccru05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:ccru00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     144224773 (H2AC25)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     144224773 (H2AC25)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     144224773 (H2AC25)  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     144224773 (H2AC25)   09165 Substance dependence    05034 Alcoholism     144224773 (H2AC25)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ccru03036]     144224773 (H2AC25)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccru04147]     144224773 (H2AC25) Chromosome and associated proteins [BR:ccru03036]  Eukaryotic type   Nucleosome assembly factors    Histones     144224773 (H2AC25) Exosome [BR:ccru04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    144224773 (H2AC25) SSDB OrthologParalogGFIT Motif Pfam:  Histone_H2A_C Histone Histone_ABTB CBFD_NFYB_HMF Clp_N Motif Other DBs NCBI-GeneID:  144224773 NCBI-ProteinID:  XP_077611991 LinkDB All DBs Position Unknown AA seq 130 aa AA seqDB search MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKK TESHHKAKGK NT seq 393 nt NT seq  +upstreamnt  +downstreamnt atgtccggccgtggcaagcagggtggtaaggcgcgcgccaaagccaagtcgcgctcgtcg cgcgcggggctgcagttccccgtgggccgcgtgcaccggttgctccgtaagggcaactac tcggagcgggttggtgccggcgcgccggtgtacttggcagcggtgctggagtacctaacg gccgagatcctggagctggcaggcaacgcggcccgagacaacaagaagacgcgcatcatc ccgcgccacctgcagctggccatccgcaacgacgaggagctcaacaagctgctgggccgc gtgaccatcgcgcagggcggcgtcctgcccaacattcaggcggtgctgctgccaaagaag acggagagccaccacaaggctaagggcaagtga

DBGET integrated database retrieval system