Crocuta crocuta (spotted hyena): 144226162 Help Entry 144226162         CDS       T11532                                  Symbol RAB5B Name (RefSeq) ras-related protein Rab-5B   KO K07888   Ras-related protein Rab-5B Organism ccru  Crocuta crocuta (spotted hyena) Pathway ccru04014   Ras signaling pathway ccru04137   Mitophagy - animal ccru04144   Endocytosis ccru04145   Phagosome ccru04148   Efferocytosis ccru04962   Vasopressin-regulated water reabsorption ccru05132   Salmonella infection ccru05146   Amoebiasis ccru05152   Tuberculosis Brite KEGG Orthology (KO) [BR:ccru00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     144226162 (RAB5B)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     144226162 (RAB5B)    04145 Phagosome     144226162 (RAB5B)    04137 Mitophagy - animal     144226162 (RAB5B)    04148 Efferocytosis     144226162 (RAB5B)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     144226162 (RAB5B)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     144226162 (RAB5B)    05152 Tuberculosis     144226162 (RAB5B)   09174 Infectious disease: parasitic    05146 Amoebiasis     144226162 (RAB5B)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ccru04131]     144226162 (RAB5B)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccru04147]     144226162 (RAB5B)    04031 GTP-binding proteins [BR:ccru04031]     144226162 (RAB5B) Membrane trafficking [BR:ccru04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     144226162 (RAB5B)  Endosome - Lysosome transport     144226162 (RAB5B) Exosome [BR:ccru04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    144226162 (RAB5B)   Exosomal proteins of other body fluids (saliva and urine)    144226162 (RAB5B)   Exosomal proteins of colorectal cancer cells    144226162 (RAB5B)   Exosomal proteins of melanoma cells    144226162 (RAB5B) GTP-binding proteins [BR:ccru04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     144226162 (RAB5B) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 Gtr1_RagA RsgA_GTPase AAA_16 Motif Other DBs NCBI-GeneID:  144226162 NCBI-ProteinID:  XP_077613596 LinkDB All DBs Position Unknown AA seq 215 aa AA seqDB search MTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQ SVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQETFARAKTWVKELQR QASPSIVIALAGNKADLANKRMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKK LPKSEPQNLGGAAGRSRGVDLHEQSQQNKSQCCSN NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atgactagcagaagcacagccaggcccaatgggcagccccaggccagcaaaatatgccag ttcaaattggtcctgctgggtgaatctgcagtggggaagtctagtctggtattacgtttt gtcaaagggcagtttcatgagtaccaggagagcaccattggagcggccttcctcacccag tctgtttgtctagatgacacaacagtcaagtttgaaatatgggacacagctgggcaggag cgataccatagcttggcccccatgtactacagaggtgcccaagctgccattgtggtttat gacattactaatcaggaaaccttcgcccgagcgaagacatgggtaaaggaactacagcga caggccagtcctagcatcgttattgccctggcggggaacaaagctgacctggccaataag cgcatggtggagtatgaagaggcccaggcgtatgcagatgacaacagcttattgtttatg gagacttcagccaagacagctatgaacgtgaacgatctcttcctggcaatagctaagaag ctgccaaagagtgaaccccagaatctggggggtgcagcaggccgaagccggggtgtggat ctccatgagcagtcccagcagaacaagagccagtgttgtagcaactga

DBGET integrated database retrieval system