Crocuta crocuta (spotted hyena): 144229151 Help Entry 144229151         CDS       T11532                                  Symbol H2BK1 Name (RefSeq) histone H2B type 2-K1   KO K11252   histone H2B Organism ccru  Crocuta crocuta (spotted hyena) Pathway ccru04613   Neutrophil extracellular trap formation ccru05034   Alcoholism ccru05203   Viral carcinogenesis ccru05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:ccru00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     144229151 (H2BK1)  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     144229151 (H2BK1)   09163 Immune disease    05322 Systemic lupus erythematosus     144229151 (H2BK1)   09165 Substance dependence    05034 Alcoholism     144229151 (H2BK1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ccru03036]     144229151 (H2BK1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccru04147]     144229151 (H2BK1) Chromosome and associated proteins [BR:ccru03036]  Eukaryotic type   Nucleosome assembly factors    Histones     144229151 (H2BK1) Exosome [BR:ccru04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    144229151 (H2BK1) SSDB OrthologParalogGFIT Motif Pfam:  Histone Histone_ABTB CBFD_NFYB_HMF YscO-like Motif Other DBs NCBI-GeneID:  144229151 NCBI-ProteinID:  XP_077617261 LinkDB All DBs Position Unknown AA seq 123 aa AA seqDB search MSAEHGQQQQQSGGRRGRSSGDKKSRKRSRRKETYSMYIYKVLKQVHPDIGISSKAMSIM NSFVNDVFERLAGEAARLAQYSGRTTLTSREVQTAVRLLLPGELAKHAVSEGTKAVTKYT SSK NT seq 372 nt NT seq  +upstreamnt  +downstreamnt atgagcgcggagcatggacagcagcagcagcagtccgggggccgcaggggccgtagttcc ggcgacaagaagtccagaaagcgtagccggcgcaaggaaacctactcgatgtacatctac aaggtgctaaagcaggtgcaccctgacattggcatctcttccaaggccatgagcatcatg aattcgtttgtgaacgatgtgtttgaacggctggccggtgaggctgcccggctggcccag tactcgggccgaaccacgctcacgtcccgggaagtccagacagccgtgcgtctgctgctg ccgggggagctggccaagcacgccgtgtccgagggcaccaaggctgtcaccaagtacacc agctccaagtga

DBGET integrated database retrieval system