Crocuta crocuta (spotted hyena): 144233095 Help Entry 144233095         CDS       T11532                                  Symbol PFN2 Name (RefSeq) profilin-2   KO K05759   profilin Organism ccru  Crocuta crocuta (spotted hyena) Pathway ccru04015   Rap1 signaling pathway ccru04810   Regulation of actin cytoskeleton ccru05014   Amyotrophic lateral sclerosis ccru05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ccru00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     144233095 (PFN2)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     144233095 (PFN2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     144233095 (PFN2)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     144233095 (PFN2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ccru04131]     144233095 (PFN2)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:ccru04812]     144233095 (PFN2)    04147 Exosome [BR:ccru04147]     144233095 (PFN2) Membrane trafficking [BR:ccru04131]  Others   Actin-binding proteins    Others     144233095 (PFN2) Cytoskeleton proteins [BR:ccru04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      144233095 (PFN2) Exosome [BR:ccru04147]  Exosomal proteins   Proteins found in most exosomes    144233095 (PFN2) SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  144233095 NCBI-ProteinID:  XP_077622020 LinkDB All DBs Position Unknown AA seq 91 aa AA seqDB search MIVGKDREGFFTNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRV LVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgattgtaggaaaagaccgggaaggtttctttaccaacggtttgactcttggcgcaaag aagtgctccgtgatcagagatagcctatacgtcgatggtgactgcacaatggacatccgg acaaagagtcaaggtggggagccaacatacaacgttgctgtcggcagagctggtagagtc ttggtctttgtaatgggaaaagaaggggtccatggaggcggattgaataagaaggcatac tcaatggcaaaatacttgagagactctgggttctag

DBGET integrated database retrieval system