Crocuta crocuta (spotted hyena): 144235642 Help Entry 144235642         CDS       T11532                                  Symbol NFKBIA Name (RefSeq) NF-kappa-B inhibitor alpha   KO K04734   NF-kappa-B inhibitor alpha Organism ccru  Crocuta crocuta (spotted hyena) Pathway ccru04024   cAMP signaling pathway ccru04062   Chemokine signaling pathway ccru04064   NF-kappa B signaling pathway ccru04210   Apoptosis ccru04380   Osteoclast differentiation ccru04620   Toll-like receptor signaling pathway ccru04621   NOD-like receptor signaling pathway ccru04622   RIG-I-like receptor signaling pathway ccru04623   Cytosolic DNA-sensing pathway ccru04625   C-type lectin receptor signaling pathway ccru04657   IL-17 signaling pathway ccru04658   Th1 and Th2 cell differentiation ccru04659   Th17 cell differentiation ccru04660   T cell receptor signaling pathway ccru04662   B cell receptor signaling pathway ccru04668   TNF signaling pathway ccru04722   Neurotrophin signaling pathway ccru04920   Adipocytokine signaling pathway ccru04926   Relaxin signaling pathway ccru04931   Insulin resistance ccru04936   Alcoholic liver disease ccru05132   Salmonella infection ccru05134   Legionellosis ccru05135   Yersinia infection ccru05140   Leishmaniasis ccru05142   Chagas disease ccru05145   Toxoplasmosis ccru05160   Hepatitis C ccru05161   Hepatitis B ccru05162   Measles ccru05163   Human cytomegalovirus infection ccru05164   Influenza A ccru05166   Human T-cell leukemia virus 1 infection ccru05167   Kaposi sarcoma-associated herpesvirus infection ccru05168   Herpes simplex virus 1 infection ccru05169   Epstein-Barr virus infection ccru05170   Human immunodeficiency virus 1 infection ccru05171   Coronavirus disease - COVID-19 ccru05200   Pathways in cancer ccru05203   Viral carcinogenesis ccru05208   Chemical carcinogenesis - reactive oxygen species ccru05215   Prostate cancer ccru05220   Chronic myeloid leukemia ccru05222   Small cell lung cancer ccru05235   PD-L1 expression and PD-1 checkpoint pathway in cancer ccru05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ccru00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     144235642 (NFKBIA)    04668 TNF signaling pathway     144235642 (NFKBIA)    04024 cAMP signaling pathway     144235642 (NFKBIA)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     144235642 (NFKBIA)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     144235642 (NFKBIA)    04621 NOD-like receptor signaling pathway     144235642 (NFKBIA)    04622 RIG-I-like receptor signaling pathway     144235642 (NFKBIA)    04623 Cytosolic DNA-sensing pathway     144235642 (NFKBIA)    04625 C-type lectin receptor signaling pathway     144235642 (NFKBIA)    04660 T cell receptor signaling pathway     144235642 (NFKBIA)    04658 Th1 and Th2 cell differentiation     144235642 (NFKBIA)    04659 Th17 cell differentiation     144235642 (NFKBIA)    04657 IL-17 signaling pathway     144235642 (NFKBIA)    04662 B cell receptor signaling pathway     144235642 (NFKBIA)    04062 Chemokine signaling pathway     144235642 (NFKBIA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     144235642 (NFKBIA)    04926 Relaxin signaling pathway     144235642 (NFKBIA)   09156 Nervous system    04722 Neurotrophin signaling pathway     144235642 (NFKBIA)   09158 Development and regeneration    04380 Osteoclast differentiation     144235642 (NFKBIA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     144235642 (NFKBIA)    05208 Chemical carcinogenesis - reactive oxygen species     144235642 (NFKBIA)    05203 Viral carcinogenesis     144235642 (NFKBIA)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     144235642 (NFKBIA)   09162 Cancer: specific types    05220 Chronic myeloid leukemia     144235642 (NFKBIA)    05215 Prostate cancer     144235642 (NFKBIA)    05222 Small cell lung cancer     144235642 (NFKBIA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     144235642 (NFKBIA)    05170 Human immunodeficiency virus 1 infection     144235642 (NFKBIA)    05161 Hepatitis B     144235642 (NFKBIA)    05160 Hepatitis C     144235642 (NFKBIA)    05171 Coronavirus disease - COVID-19     144235642 (NFKBIA)    05164 Influenza A     144235642 (NFKBIA)    05162 Measles     144235642 (NFKBIA)    05168 Herpes simplex virus 1 infection     144235642 (NFKBIA)    05163 Human cytomegalovirus infection     144235642 (NFKBIA)    05167 Kaposi sarcoma-associated herpesvirus infection     144235642 (NFKBIA)    05169 Epstein-Barr virus infection     144235642 (NFKBIA)   09171 Infectious disease: bacterial    05132 Salmonella infection     144235642 (NFKBIA)    05135 Yersinia infection     144235642 (NFKBIA)    05134 Legionellosis     144235642 (NFKBIA)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     144235642 (NFKBIA)    05140 Leishmaniasis     144235642 (NFKBIA)    05142 Chagas disease     144235642 (NFKBIA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     144235642 (NFKBIA)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     144235642 (NFKBIA)    04931 Insulin resistance     144235642 (NFKBIA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:ccru03000]     144235642 (NFKBIA)    04131 Membrane trafficking [BR:ccru04131]     144235642 (NFKBIA) Transcription factors [BR:ccru03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Ankyrin only     144235642 (NFKBIA) Membrane trafficking [BR:ccru04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     144235642 (NFKBIA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ank_2 Ank Ank_3 Ank_5 Ank_4 ANK_LRRK2 Motif Other DBs NCBI-GeneID:  144235642 NCBI-ProteinID:  XP_077625336 LinkDB All DBs Position Unknown AA seq 314 aa AA seqDB search MFHPAEHAQDWAMEGPRDALKKERLLDDSRDSGLDSMKDEEYEQMVKELREIRLEPQEAP RGAEPWKQQLTEDGDSFLHLAIIHEEKALTMEVVRQVKGDLAFLNFQNNLQQTPLHLAVI TNQPEIAEALLEAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQTCRTQHLYSILQATN YNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNSDLVSLLLKCG ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEDEL PYDDCVLGGQRLTL NT seq 945 nt NT seq  +upstreamnt  +downstreamnt atgtttcaccccgccgagcacgcccaggactgggccatggagggtccccgggatgcgctc aagaaggagcggctgctggacgacagccgcgacagcggcctggactccatgaaggacgag gagtatgagcagatggtgaaggagctgcgggagatccgcctcgagccccaggaggcgccg cgcggcgccgagccctggaagcagcagctcaccgaggacggagactcgttcctgcacttg gccatcatccatgaagagaaggcattgaccatggaagtggtccgccaagtgaaaggagac ctggcctttctcaatttccagaacaacctgcagcagactcctctccacttggctgtgatc accaaccaaccagaaattgctgaggcacttctggaagctggctgtgatcctgagctccga gactttcgaggaaatacccccctacacctcgcctgtgagcaaggctgcctggccagtgtg ggagtcctgactcagacctgcaggacccagcacctctactccatcctgcaggccaccaac tacaatggtcacacgtgtctgcacttagcctctatccacggctacctgggtatcgtggag ctcttggtgtctttgggtgctgatgtcaatgctcaggagccctgtaatggccgaaccgcc ctccaccttgcagtggacctgcagaattccgacctcgtgtcgcttttattgaaatgcgga gctgacgtcaacagggtcacctaccaaggctactccccctaccagctcacctggggccgc ccaagcactcggatacagcagcagctgggccagctgaccttagaaaaccttcagatgctg ccagagagtgaggatgaggagagctatgacacggagtcagagttcacagaggacgagctg ccctatgacgactgtgtgcttggaggccaacgcctgacgttatga

DBGET integrated database retrieval system