Crocuta crocuta (spotted hyena): 144239379 Help Entry 144239379         CDS       T11532                                  Symbol BCL2L11 Name (RefSeq) bcl-2-like protein 11 isoform X1   KO K16341   Bcl-2-like protein 11 Organism ccru  Crocuta crocuta (spotted hyena) Pathway ccru01521   EGFR tyrosine kinase inhibitor resistance ccru04068   FoxO signaling pathway ccru04151   PI3K-Akt signaling pathway ccru04210   Apoptosis ccru04215   Apoptosis - multiple species ccru04932   Non-alcoholic fatty liver disease ccru05169   Epstein-Barr virus infection ccru05200   Pathways in cancer ccru05206   MicroRNAs in cancer ccru05210   Colorectal cancer Brite KEGG Orthology (KO) [BR:ccru00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     144239379 (BCL2L11)    04151 PI3K-Akt signaling pathway     144239379 (BCL2L11)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     144239379 (BCL2L11)    04215 Apoptosis - multiple species     144239379 (BCL2L11)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     144239379 (BCL2L11)    05206 MicroRNAs in cancer     144239379 (BCL2L11)   09162 Cancer: specific types    05210 Colorectal cancer     144239379 (BCL2L11)   09172 Infectious disease: viral    05169 Epstein-Barr virus infection     144239379 (BCL2L11)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     144239379 (BCL2L11)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     144239379 (BCL2L11) SSDB OrthologParalogGFIT Motif Pfam:  Bclx_interact Bim_N Motif Other DBs NCBI-GeneID:  144239379 NCBI-ProteinID:  XP_077629537 LinkDB All DBs Position Unknown AA seq 196 aa AA seqDB search MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQGNPEGEGDRCPQGSPQGPL APPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAF NHYLSAMASMRQSQAVPADMRPEIWIAQELRRIGDEFNAYYPRRVFLNNYQAAEAHPQMI ILRLLRYIVRLVWRLQ NT seq 591 nt NT seq  +upstreamnt  +downstreamnt atggcaaagcaaccttcagatgtaagttctgagtgtgacagagaaggcggacaattgcag cctgctgagagacctcctcagctcaggcctggggcgcctacctctctacagacggagccg caaggtaatcctgaaggcgaaggggaccgctgcccgcaaggcagcccgcagggcccgctg gccccaccagccagccccgggccttttgctaccagatccccgcttttcatctttgtgaga agatcctccctgctgtctcgatcctccagtgggtatttctcttttgacacagacaggagc ccggcgcccatgagttgtgacaaatcaacacaaaccccaagtcctccttgccaggccttc aaccattatctcagtgcaatggcatccatgaggcagtctcaggctgtacctgcagatatg cgcccggagatatggatcgcacaggagctgcggcgtattggagacgaatttaatgcatat tacccaaggagggtctttttgaataattaccaagcagcagaagcccacccccaaatgatt atcttacgactgctacgttacatcgtccgcctggtgtggcgattgcagtga

DBGET integrated database retrieval system