Crocuta crocuta (spotted hyena): 144240645 Help Entry 144240645         CDS       T11532                                  Symbol CCL28 Name (RefSeq) C-C motif chemokine 28   KO K05513   C-C motif chemokine 28 Organism ccru  Crocuta crocuta (spotted hyena) Pathway ccru04060   Cytokine-cytokine receptor interaction ccru04061   Viral protein interaction with cytokine and cytokine receptor ccru04062   Chemokine signaling pathway ccru04672   Intestinal immune network for IgA production Brite KEGG Orthology (KO) [BR:ccru00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     144240645 (CCL28)    04061 Viral protein interaction with cytokine and cytokine receptor     144240645 (CCL28)  09150 Organismal Systems   09151 Immune system    04672 Intestinal immune network for IgA production     144240645 (CCL28)    04062 Chemokine signaling pathway     144240645 (CCL28)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ccru04052]     144240645 (CCL28) Cytokines and neuropeptides [BR:ccru04052]  Cytokines   Chemokines    144240645 (CCL28) SSDB OrthologParalogGFIT Other DBs NCBI-GeneID:  144240645 NCBI-ProteinID:  XP_077631143 LinkDB All DBs Position Unknown AA seq 139 aa AA seqDB search MWLRFAATGTTRFSLPPLFPSSSSSLGPGSGSSTKSPALTLLLRGRHDRRHVSATAVKRR DVALLLAAPPPYLWFCLHIRRRRLCVSPHSHVIKQWMKEQAAKKNAKGNLCHRKKQDGKG NSKGARHGKPETRGHQTPY NT seq 420 nt NT seq  +upstreamnt  +downstreamnt atgtggctccgctttgccgcaacaggcaccacccgcttctcgttgccgccgctcttcccc tcctcctcctcgtccttgggcccgggctccggttccagcaccaagtctcccgctctcacc ctcctgcttcgtggccgccatgaccgcagacacgtgagcgcaacggccgtaaaacgccgc gacgtcgcgcttttgctcgccgccccgccgccctatctttggttttgccttcacatccgg cgcaggaggctctgcgtcagcccgcacagtcacgtcattaagcagtggatgaaagaacaa gcggccaagaagaacgctaaaggcaacctctgccacaggaagaaacaggacggcaagggg aacagtaaaggggcgcgtcacgggaaacccgaaacccgtggccatcagactccttattaa

DBGET integrated database retrieval system