Crocuta crocuta (spotted hyena): 144245244 Help Entry 144245244         CDS       T11532                                  Symbol H2AB1 Name (RefSeq) histone H2A-Bbd type 1   KO K11251   histone H2A Organism ccru  Crocuta crocuta (spotted hyena) Pathway ccru03082   ATP-dependent chromatin remodeling ccru04217   Necroptosis ccru04613   Neutrophil extracellular trap formation ccru05034   Alcoholism ccru05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:ccru00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     144245244 (H2AB1)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     144245244 (H2AB1)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     144245244 (H2AB1)  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     144245244 (H2AB1)   09165 Substance dependence    05034 Alcoholism     144245244 (H2AB1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ccru03036]     144245244 (H2AB1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccru04147]     144245244 (H2AB1) Chromosome and associated proteins [BR:ccru03036]  Eukaryotic type   Nucleosome assembly factors    Histones     144245244 (H2AB1) Exosome [BR:ccru04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    144245244 (H2AB1) SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF Histone_ABTB Motif Other DBs NCBI-GeneID:  144245244 NCBI-ProteinID:  XP_077636795 LinkDB All DBs Position Unknown AA seq 113 aa AA seqDB search MPGNTSRQGPSGAQSHVGSRTARAQLSFSVSYVEHLLREGHYSKRLGESAPIFLAAVIEF LTTKVLELAGVEARNRGRRLITPDLLDMAVHNHTLLSDFFQSTTISQVGPGQK NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atgccggggaacacgagccgtcaagggccatccggtgcccagagccacgtcggctcccgc actgcccgagcacagttgtcgttctctgtgagctacgtggagcacctcctgcgggagggc cactactcgaagcgcctgggcgagtccgcaccgatctttctagcggccgtcatcgagttc ctgacgaccaaagtcctggagctggcgggcgtcgaggcccggaacagaggcaggaggctc atcaccccggatctcctggacatggcggtccacaaccacacgctgctcagcgacttcttc cagtccacgaccatctcccaggtgggcccgggccagaagtag

DBGET integrated database retrieval system