Caulobacter vibrioides NA1000: CCNA_02036 Help Entry CCNA_02036        CDS       T00841                                  Name (RefSeq) DNA-binding protein HU   KO K03530   DNA-binding protein HU-beta Organism ccs  Caulobacter vibrioides NA1000 Brite KEGG Orthology (KO) [BR:ccs00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:ccs03032]     CCNA_02036    03036 Chromosome and associated proteins [BR:ccs03036]     CCNA_02036    03400 DNA repair and recombination proteins [BR:ccs03400]     CCNA_02036 DNA replication proteins [BR:ccs03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     CCNA_02036 Chromosome and associated proteins [BR:ccs03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     CCNA_02036 DNA repair and recombination proteins [BR:ccs03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       CCNA_02036 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 DUF2267 DUF3863 Motif Other DBs NCBI-GeneID:  7333367 NCBI-ProteinID:  YP_002517409 UniProt:  B8GX11 LinkDB All DBs Position complement(2180650..2180928) Genome browser AA seq 92 aa AA seqDB search MTTKAELVTAIAEKAGINKNQAKDALEAFIEAVTDSLKSGQDVRLVGFGTFKAVTRAAGT ARNPRTGETVNRPASKTARFQVGEGLKSSLNS NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaccacaaaagccgagctcgttacggcgatcgccgagaaggcgggcatcaacaagaac caggccaaggacgcgctggaagcctttatcgaagcggttacggactcgctgaaatcgggc caagacgtgcgtcttgtcggctttggcaccttcaaggccgtgacccgcgcggctggaacc gcgcgtaatccccgtaccggtgagaccgtcaaccgtcccgcgtccaagacggcccgcttc caggtcggcgaaggtctgaagtcttcgctcaacagctag

DBGET integrated database retrieval system