Campylobacter cuniculorum: CCUN_1352 Help Entry CCUN_1352         CDS       T05046                                  Symbol acpP2 Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ccun  Campylobacter cuniculorum Pathway ccun01100   Metabolic pathways ccun01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ccun00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CCUN_1352 (acpP2)    00074 Mycolic acid biosynthesis     CCUN_1352 (acpP2)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CCUN_1352 (acpP2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Ribosomal_L12_N PP-binding_2 Motif Other DBs NCBI-ProteinID:  ARJ56940 UniProt:  A0A1W6BY30 LinkDB All DBs Position 1364538..1364771 Genome browser AA seq 77 aa AA seqDB search MATFDDVKAVVVEQLSIDSDAVKMESKIIEDLGADSLDVVELIMALEEKFEVEIPDSDAE KLIKIEDVVNYIDNLKK NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggcaacatttgacgatgtaaaggcagtagttgtagaacagcttagtattgattcggat gcagtaaaaatggaatcaaaaattattgaggatttaggtgcagattctttagatgtggta gagcttattatggctttagaagaaaaatttgaagtcgaaattcctgatagtgatgccgaa aaactgattaagattgaagatgttgtaaattatattgataatcttaaaaaataa

DBGET integrated database retrieval system