KEGG   Cupriavidus sp. USMAHM13: BKK81_00385
Entry
BKK81_00385       CDS       T04762                                 
Name
(GenBank) 50S ribosomal protein L18
  KO
K02881  large subunit ribosomal protein L18
Organism
ccup  Cupriavidus sp. USMAHM13
Pathway
ccup03010  Ribosome
Brite
KEGG Orthology (KO) [BR:ccup00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BKK81_00385
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ccup03011]
    BKK81_00385
Ribosome [BR:ccup03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BKK81_00385
  Bacteria
    BKK81_00385
  Archaea
    BKK81_00385
SSDB
Motif
Pfam: Ribosomal_L18p 2-Hacid_dh_C SHPRH_helical-2nd
Other DBs
NCBI-ProteinID: AOY97923
LinkDB
Position
1:complement(74356..74712)
AA seq 118 aa
MNKKDARLRRARQTRAKIAELKVNRLTVFRTNSHIYAQVYSPCGTQVVASASTLEAEVRK
ELTGSGATTAAATVIGKRIAEKAKAAGVEIVAFDRAGFRFHGRVKALADAAREAGLKF
NT seq 357 nt   +upstreamnt  +downstreamnt
atgaacaagaaagacgctcgtttgcgccgtgcacgtcagacccgcgcgaagatcgcggaa
ctgaaagtgaatcgtctgacggtgttccgcacgaactcgcatatttacgctcaggtctac
tcgccgtgcggcacccaagtggtggcctcggcttcgaccctcgaagcagaagtgcgcaag
gaactgaccggcagtggcgcgaccaccgccgccgccaccgtgattggcaagcgcatcgcc
gagaaggcgaaggctgccggcgtggaaatcgtcgcgttcgatcgcgccggcttccgcttc
cacggccgcgtgaaggctctggctgacgctgcacgcgaagccggcctcaagttctaa

DBGET integrated database retrieval system