Cupriavidus sp. USMAHM13: BKK81_14645 Help Entry BKK81_14645       CDS       T04762                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ccup  Cupriavidus sp. USMAHM13 Pathway ccup00998   Biosynthesis of various antibiotics ccup01100   Metabolic pathways ccup01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ccup00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BKK81_14645    00074 Mycolic acid biosynthesis     BKK81_14645   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BKK81_14645 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 DUF1896 DUF1493 MAP Motif Other DBs NCBI-ProteinID:  AOZ00335 LinkDB All DBs Position 1:complement(3326055..3326294) Genome browser AA seq 79 aa AA seqDB search MDNIEQRVKKIVAEQLGVAEADIKNESSFVNDLGADSLDTVELVMALEDEFGMEIPDEEA EKITTVQQAIDYATAHVKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggacaatatcgaacaacgcgtcaagaaaatcgtggcagaacagcttggcgtggccgag gcggacatcaagaacgaatcgtcgttcgtgaacgacctgggcgccgactcgctcgacacg gttgaactcgtgatggcgttggaagatgaattcggcatggaaattcccgatgaggaagcc gaaaagatcaccaccgtgcagcaggcgatcgactacgccaccgcgcacgtcaaggcctga

DBGET integrated database retrieval system