KEGG   Cupriavidus sp. USMAHM13: BKK81_17395
Entry
BKK81_17395       CDS       T04762                                 
Name
(GenBank) signal recognition particle protein
  KO
K03106  signal recognition particle subunit SRP54 [EC:3.6.5.4]
Organism
ccup  Cupriavidus sp. USMAHM13
Pathway
ccup02024  Quorum sensing
ccup03060  Protein export
ccup03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ccup00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    BKK81_17395
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BKK81_17395
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BKK81_17395
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ccup02044]
    BKK81_17395
Enzymes [BR:ccup01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.4  signal-recognition-particle GTPase
     BKK81_17395
Secretion system [BR:ccup02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   BKK81_17395
  Eukaryotic Sec-SRP protein
   BKK81_17395
SSDB
Motif
Pfam: SRP54 SRP_SPB SRP54_N AAA_22 CbiA Zeta_toxin AAA_16 T2SSE AAA_31 AAA_30 YqeC AAA_14 AAA_19 nSTAND3 cobW AAA_33 Thymidylate_kin Helicase_RecD ATP_bind_1 APS_kinase TsaE Rad17 NACHT ArsA_ATPase KTI12 AAA_18 AAA Vps53_N LPD22
Other DBs
NCBI-ProteinID: AOZ00827
LinkDB
Position
1:3932611..3933999
AA seq 462 aa
MLDNLTQRLARVVKTMRGEARLTEANTAEMLREVRLAMLEADVALPVVREFIARVKEKAM
GEEVVSSLTPGQALVGVVQRELTAVIGGEESLQGKSAELNLAVQPPAIILMAGLQGAGKT
TTVGKLAKWLKENKKKKVLTVSCDVYRPAAIAQLKTVSEQVGAEFFPSQPDQKPVDIARA
ALDWARKHYADVLIVDTAGRLGIDEAMMQEIAALHAELKPAETLFVVDAMLGQDAVNTAK
AFNDALPLTGVVLTKLDGDARGGAALSVRHITGRPIKFVGVGEKLDGLEPFYPDRMAQRI
LGMGDILALVEEAQRGVDMEAAEKLAKKIKKTGDFDLEDFKAQIGQMKKMGGLGSLVDKL
PAQFAQQAQGANMDQAEKQVRRMEGIINSMTPAERAKPDLIKASRKRRIAAGAGVPVQEV
NRLLNQFDQMQGMMKKLKGGGMMKLMRSMGAMKGGMKGLFNR
NT seq 1389 nt   +upstreamnt  +downstreamnt
atgctggacaatctcactcaacgcttggcgcgggtcgtcaagaccatgcgcggcgaggct
cgcctgaccgaggccaataccgccgaaatgctgcgcgaagtgcgcctcgccatgctcgag
gccgacgtcgccctgcccgtcgtgcgcgagttcatcgcgcgcgtgaaggaaaaggccatg
ggcgaggaggtggtctccagcctcacgccgggccaggccctggtcggggtggtgcagcgc
gagctgaccgcggtgatcggcggcgaggaaagcctgcagggcaagagcgccgaactgaac
ctggcagtgcagccgcccgccatcatcctgatggccggcctgcagggcgcgggcaagacc
accacggtgggcaagctggccaagtggctcaaggagaacaagaagaagaaggtgctgacg
gtctcctgcgacgtctaccgccccgccgcgatcgcccagttgaagacggtgtccgagcag
gtcggcgcggagttcttcccctcccagccggaccagaaaccggtcgacatcgcacgcgcg
gcgctggactgggcgcgcaagcactatgccgacgtgctgatcgtcgacaccgccggccgc
ctgggcatcgacgaggcgatgatgcaggagatcgccgcgctgcacgccgagctcaagccc
gccgagaccctgttcgtggtcgatgccatgctgggccaggacgcggtcaataccgccaag
gccttcaatgacgcgctgccgctgaccggagtggtgctgaccaagctcgacggcgacgca
cgcggcggcgctgcgctgtcggtgcgccacatcaccggcaggccgatcaagttcgtcggc
gtcggcgagaagctcgacggcctggagcccttctaccccgatcgcatggcccagcggatc
ctgggcatgggcgacatcctcgccctggtcgaggaggcgcagcgcggcgtcgacatggaa
gcggccgagaaactggccaagaagatcaagaagaccggcgacttcgacctggaagacttc
aaggcacagatcggccagatgaagaagatgggtggactgggcagcctggtggacaagctg
ccggcccagttcgcgcagcaggcccagggcgccaacatggaccaggccgagaagcaggtg
cgccgcatggagggcatcatcaacagcatgacgcccgccgagcgcgccaagccggacctg
atcaaggccagccgcaagcgccgtatcgccgccggcgccggtgtgccggtgcaggaagtc
aaccggttgctcaaccagttcgatcagatgcagggcatgatgaagaagctcaagggcggc
ggcatgatgaagctgatgcgctcgatgggcgccatgaaaggcggcatgaaagggttgttc
aaccgctga

DBGET integrated database retrieval system