Cupriavidus sp. USMAHM13: BKK81_27100 Help Entry BKK81_27100       CDS       T04762                                  Name (GenBank) 4-oxalocrotonate tautomerase   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism ccup  Cupriavidus sp. USMAHM13 Pathway ccup00362   Benzoate degradation ccup00621   Dioxin degradation ccup00622   Xylene degradation ccup01100   Metabolic pathways ccup01120   Microbial metabolism in diverse environments ccup01220   Degradation of aromatic compounds Module ccup_M00569   Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA Brite KEGG Orthology (KO) [BR:ccup00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     BKK81_27100    00622 Xylene degradation     BKK81_27100    00621 Dioxin degradation     BKK81_27100 Enzymes [BR:ccup01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      BKK81_27100 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tautomerase Tautomerase_2 Tautomerase_3 TA_inhibitor FTCD_C Motif Other DBs NCBI-ProteinID:  AOZ02846 LinkDB All DBs Position 2:2004227..2004418 Genome browser AA seq 63 aa AA seqDB search MPIMQVFLIEGRTEEQKARLIAALTDAAVESIGAPRETVRVMLQEMPKEHFSIGGKTAKE LGR NT seq 192 nt NT seq  +upstreamnt  +downstreamnt atgcccatcatgcaagtcttcctgatcgaaggccgcaccgaagaacagaaggcgcgcctg atcgccgcgctgaccgatgcggcggtcgagtcgatcggcgcgccgcgcgaaacggtgcgg gtgatgctgcaggaaatgcccaaggagcacttcagcatcggcggcaagacagccaaggag ctgggacgctga

DBGET integrated database retrieval system