Cupriavidus sp. USMAHM13: BKK81_28675 Help Entry BKK81_28675       CDS       T04762                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ccup  Cupriavidus sp. USMAHM13 Pathway ccup00998   Biosynthesis of various antibiotics ccup01100   Metabolic pathways ccup01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ccup00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BKK81_28675    00074 Mycolic acid biosynthesis     BKK81_28675   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BKK81_28675 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AOZ03105 LinkDB All DBs Position 2:2364435..2364695 Genome browser AA seq 86 aa AA seqDB search MNELETELARLIIGELDITDIALADVRPDTPLYGEGFGLDSIDILEIALLVSKKYGFELR SDNPDNKRIFQSLGSLAAYTQQQRSR NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgaacgaactggaaaccgaactcgcgcgcctgatcatcggcgaactcgacatcacggat atcgcgctggccgacgtccggcccgatacaccgctctatggcgagggattcggcctggac tcgatcgacatcctcgagatcgcgctgctcgtgtccaagaaatacggcttcgaactgcgc tcggacaatccggacaacaagcgcattttccagtcgctgggcagcctggcggcctatacg caacaacagcggtcacgctga

DBGET integrated database retrieval system