Cupriavidus sp. USMAHM13: BKK81_33415 Help Entry BKK81_33415       CDS       T04762                                  Name (GenBank) DNA-binding protein   KO K03746   DNA-binding protein H-NS Organism ccup  Cupriavidus sp. USMAHM13 Brite KEGG Orthology (KO) [BR:ccup00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ccup03036]     BKK81_33415    03400 DNA repair and recombination proteins [BR:ccup03400]     BKK81_33415 Chromosome and associated proteins [BR:ccup03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     BKK81_33415 DNA repair and recombination proteins [BR:ccup03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       BKK81_33415 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Histone_HNS_N Motif Other DBs NCBI-ProteinID:  AOZ04287 LinkDB All DBs Position unnamed1:132705..132959 Genome browser AA seq 84 aa AA seqDB search MSVEIERAEAVTWIRVQMARHGITPADLLAAGCFGPRPRQRATVATPARYANANGQTWDG EGAMPDWLQRAVNAGQSADFFRQF NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgtcagttgaaattgaacgcgccgaggcggtgacctggattcgagtccagatggcccgt catggcatcacccccgcagacctgctggcggccggctgcttcggcccgcgcccgcgccag cgcgccactgtcgccacgcccgcccgctatgccaatgccaacggccaaacctgggacggc gagggggctatgcccgattggctgcagcgcgcggtcaacgccgggcagtccgcagacttc ttccgccagttttag

DBGET integrated database retrieval system