Cylindrospermopsis curvispora: IAR63_04410 Help Entry IAR63_04410       CDS       T06771                                  Name (GenBank) hypothetical protein   KO K03666   host factor-I protein Organism ccur  Cylindrospermopsis curvispora Pathway ccur02024   Quorum sensing ccur03018   RNA degradation Brite KEGG Orthology (KO) [BR:ccur00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     IAR63_04410  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     IAR63_04410  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:ccur03019]     IAR63_04410    03036 Chromosome and associated proteins [BR:ccur03036]     IAR63_04410 Messenger RNA biogenesis [BR:ccur03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      IAR63_04410 Chromosome and associated proteins [BR:ccur03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     IAR63_04410 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq_1 DUF3107 Motif Other DBs NCBI-ProteinID:  QNP30310 UniProt:  A0A7H0F2P4 LinkDB All DBs Position 924773..925009 Genome browser AA seq 78 aa AA seqDB search MPPIEFDTTLPSIRQIQNWIKQKTTVQFKLTTGDTITARIFWQDVNCICVVDSQDDHIII SRLAIAYLKVSHDSSPPT NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgccacccatagaatttgatactactctacccagtattcgacaaatacaaaattggatc aagcagaaaactactgtgcagtttaaattgactaccggtgatactatcactgctaggatt ttttggcaagatgttaactgtatatgtgtggtggattctcaagatgatcatattataatt agtagactggctattgcctatttaaaggtgtcccatgacagcagtccaccaacataa

DBGET integrated database retrieval system