Corvus cornix (hooded crow): 104683253 Help Entry 104683253         CDS       T03546                                  Symbol RHOA Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism ccw  Corvus cornix (hooded crow) Pathway ccw04081   Hormone signaling ccw04144   Endocytosis ccw04150   mTOR signaling pathway ccw04270   Vascular smooth muscle contraction ccw04310   Wnt signaling pathway ccw04350   TGF-beta signaling pathway ccw04510   Focal adhesion ccw04520   Adherens junction ccw04530   Tight junction ccw04621   NOD-like receptor signaling pathway ccw04625   C-type lectin receptor signaling pathway ccw04810   Regulation of actin cytoskeleton ccw05100   Bacterial invasion of epithelial cells ccw05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ccw00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     104683253 (RHOA)    04350 TGF-beta signaling pathway     104683253 (RHOA)    04150 mTOR signaling pathway     104683253 (RHOA)   09133 Signaling molecules and interaction    04081 Hormone signaling     104683253 (RHOA)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     104683253 (RHOA)   09144 Cellular community - eukaryotes    04510 Focal adhesion     104683253 (RHOA)    04520 Adherens junction     104683253 (RHOA)    04530 Tight junction     104683253 (RHOA)   09142 Cell motility    04810 Regulation of actin cytoskeleton     104683253 (RHOA)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     104683253 (RHOA)    04625 C-type lectin receptor signaling pathway     104683253 (RHOA)   09153 Circulatory system    04270 Vascular smooth muscle contraction     104683253 (RHOA)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     104683253 (RHOA)    05100 Bacterial invasion of epithelial cells     104683253 (RHOA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ccw04131]     104683253 (RHOA)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccw04147]     104683253 (RHOA)    04031 GTP-binding proteins [BR:ccw04031]     104683253 (RHOA) Membrane trafficking [BR:ccw04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     104683253 (RHOA) Exosome [BR:ccw04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    104683253 (RHOA)   Exosomal proteins of other body fluids (saliva and urine)    104683253 (RHOA)   Exosomal proteins of colorectal cancer cells    104683253 (RHOA)   Exosomal proteins of bladder cancer cells    104683253 (RHOA) GTP-binding proteins [BR:ccw04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     104683253 (RHOA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  104683253 NCBI-ProteinID:  XP_039414770 LinkDB All DBs Position 12:6487277..6510983 Genome browser AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKKSGCLLL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggcagccattcgaaaaaagctggttatagtgggagatggtgcctgtggaaagacctgt ctgctgattgtatttagcaaagaccagttccctgaagtgtatgttcccactgtctttgaa aattatgtagcagatattgaagtggatggaaagcaggttgagttggctttgtgggataca gcaggacaggaagactacgatcgacttagaccgctttcttatccagatactgatgttata cttatgtgtttttcaattgatagtcctgatagtttagaaaacatcccagagaagtggacc ccagaggtgaagcatttctgccccaacgtgcctatcatcttggtaggaaacaagaaggac ctgaggaatgacgagcacacaagacgagagctggccaaaatgaagcaggagcctgtcaaa cccgaggaaggccgggatatggcaaaccgcattggtgcattcgggtacatggagtgttcg gcaaagaccaaagacggtgtgagggaggtgtttgaaatggccactagagctgctttgcaa gcccggcgtggcaagaaaaagtccgggtgccttctcttataa

DBGET integrated database retrieval system