Corvus cornix (hooded crow): 104683283 Help Entry 104683283         CDS       T03546                                  Symbol RAB7A Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism ccw  Corvus cornix (hooded crow) Pathway ccw04137   Mitophagy - animal ccw04140   Autophagy - animal ccw04144   Endocytosis ccw04145   Phagosome ccw04148   Efferocytosis ccw05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ccw00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     104683283 (RAB7A)    04145 Phagosome     104683283 (RAB7A)    04140 Autophagy - animal     104683283 (RAB7A)    04137 Mitophagy - animal     104683283 (RAB7A)    04148 Efferocytosis     104683283 (RAB7A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     104683283 (RAB7A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ccw04131]     104683283 (RAB7A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccw04147]     104683283 (RAB7A)    04031 GTP-binding proteins [BR:ccw04031]     104683283 (RAB7A) Membrane trafficking [BR:ccw04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     104683283 (RAB7A) Exosome [BR:ccw04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    104683283 (RAB7A)   Exosomal proteins of other body fluids (saliva and urine)    104683283 (RAB7A)   Exosomal proteins of colorectal cancer cells    104683283 (RAB7A)   Exosomal proteins of bladder cancer cells    104683283 (RAB7A) GTP-binding proteins [BR:ccw04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     104683283 (RAB7A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA ATP_bind_1 cobW nSTAND3 PduV-EutP Septin AAA_7 NTPase_1 AAA_22 AAA_16 AAA_24 G-alpha AAA_5 ATPase_2 AAA_14 NACHT NB-ARC FLYWCH_N ATP-synt_ab ABC_tran Motif Other DBs NCBI-GeneID:  104683283 NCBI-ProteinID:  XP_039414703 LinkDB All DBs Position 12:complement(8934592..8953682) Genome browser AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDKTDRAKASAESCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacgtctaggaagaaagtgttactgaaagtcatcatccttggagactctggggtggga aagacatcactcatgaaccagtatgtgaacaagaaattcagtaaccagtacaaggctacg ataggtgcagacttcctgacaaaagaggtgatggtggatgacaggctagtgacaatgcag atatgggatacagcaggccaagaacggtttcagtctctgggagttgccttctacagggga gcagactgctgtgtgctggtgtttgatgtcacggcccccaacacattcaaaaccctagac agctggagggacgaattcctcattcaggccagtccaagggatcctgagaactttcctttt gttgtgctgggaaacaagattgacctagaaaacagacaagtcaccacaaaacgggcacaa gcctggtgctacagtaaaaacaacatcccctactttgaaaccagtgccaaggaggccatt aacgtggaacaagctttccagacgattgcacgaaatgcacttaaacaggaaaccgaagtg gagctttacaatgaattccctgaacccatcaaactagacaagactgaccgagcgaaggct tctgcggagagctgcagctgctga

DBGET integrated database retrieval system