Corvus cornix (hooded crow): 104683871 Help Entry 104683871         CDS       T03546                                  Symbol CALML4 Name (RefSeq) calmodulin-like protein 4   KO K02183   calmodulin Organism ccw  Corvus cornix (hooded crow) Pathway ccw04020   Calcium signaling pathway ccw04070   Phosphatidylinositol signaling system ccw04114   Oocyte meiosis ccw04218   Cellular senescence ccw04261   Adrenergic signaling in cardiomyocytes ccw04270   Vascular smooth muscle contraction ccw04371   Apelin signaling pathway ccw04625   C-type lectin receptor signaling pathway ccw04744   Phototransduction ccw04910   Insulin signaling pathway ccw04912   GnRH signaling pathway ccw04916   Melanogenesis Brite KEGG Orthology (KO) [BR:ccw00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     104683871 (CALML4)    04020 Calcium signaling pathway     104683871 (CALML4)    04070 Phosphatidylinositol signaling system     104683871 (CALML4)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     104683871 (CALML4)    04218 Cellular senescence     104683871 (CALML4)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     104683871 (CALML4)   09152 Endocrine system    04910 Insulin signaling pathway     104683871 (CALML4)    04912 GnRH signaling pathway     104683871 (CALML4)    04916 Melanogenesis     104683871 (CALML4)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     104683871 (CALML4)    04270 Vascular smooth muscle contraction     104683871 (CALML4)   09157 Sensory system    04744 Phototransduction     104683871 (CALML4)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:ccw01009]     104683871 (CALML4)   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ccw04131]     104683871 (CALML4)    03036 Chromosome and associated proteins [BR:ccw03036]     104683871 (CALML4)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccw04147]     104683871 (CALML4) Protein phosphatases and associated proteins [BR:ccw01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      104683871 (CALML4) Membrane trafficking [BR:ccw04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     104683871 (CALML4) Chromosome and associated proteins [BR:ccw03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      104683871 (CALML4) Exosome [BR:ccw04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    104683871 (CALML4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_6 EF-hand_9 EF-hand_1 AIF-1 EF-hand_8 EF-hand_5 EF_EFCAB10_C LisH_WDR26 GPHH Motif Other DBs NCBI-GeneID:  104683871 NCBI-ProteinID:  XP_039413632 LinkDB All DBs Position 10:complement(11890523..11893692) Genome browser AA seq 153 aa AA seqDB search MAKFLSQDQINEFKECFSLYDKKQKGKIKASELLAVMRCLGASPTPGEVQRHLHLHRIDR NAELDFSTFLNIMYRQMKQEEPEKEILTALAMIDRQKRGVITVPELRAKLTQLGEKLSEE EVDDLLKEAKVGPNGTIRYEEFVRLICLPLADY NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atggcaaagtttctgtcccaggatcaaattaatgagttcaaggaatgtttttccctgtac gacaagaagcagaaaggcaagatcaaagcctcggagctgctggccgtgatgaggtgcctg ggagccagccccacgccaggggaggtgcagagacacctgcacctgcacaggatcgacagg aacgcagagctggacttctccaccttcctgaacatcatgtacaggcagatgaagcaggag gagcccgagaaggagatcctgacggccctggccatgatcgaccggcagaagagaggggtc atcaccgtgcccgagctccgggccaagctcacccagctgggtgagaagctttccgaggaa gaagtcgatgacctgctgaaagaggccaaagttgggccaaacggaaccatccgatacgaa gaatttgtgcgcctcatttgcctccctttggccgactactga

DBGET integrated database retrieval system