Corvus cornix (hooded crow): 104686559 Help Entry 104686559         CDS       T03546                                  Name (RefSeq) C-C motif chemokine 19   KO K05512   C-C motif chemokine 19 Organism ccw  Corvus cornix (hooded crow) Pathway ccw04060   Cytokine-cytokine receptor interaction Brite KEGG Orthology (KO) [BR:ccw00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     104686559  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ccw04052]     104686559 Cytokines and neuropeptides [BR:ccw04052]  Cytokines   Chemokines    104686559 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  104686559 NCBI-ProteinID:  XP_010393372 LinkDB All DBs Position Z:15360091..15363282 Genome browser AA seq 99 aa AA seqDB search MQQLHLLCLSLLVLGHILDVHGGNNVLDCCLRTSETPIPRRIVQDYRLQLVQDGCDIPAA IFITTKGKRLCAPLHSLWVIRLRERLDASSAQRAKHQGK NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgcagcagcttcaccttctctgcctcagtctcctggtgctgggacatatcctggatgtg catggcgggaacaacgtcctggactgctgcctgcggacaagcgagacgcccatcccgcgg cggatagtgcaggattatcggctccagctggtgcaggacggctgcgacatccctgctgcc atattcatcaccacaaagggcaagcgcctctgtgcacccctccattccctgtgggtgatt cgtctccgagagaggctggatgccagctctgcccagagggccaaacaccaaggcaagtag

DBGET integrated database retrieval system