Corvus cornix (hooded crow): 104688426 Help Entry 104688426         CDS       T03546                                  Symbol POLE3 Name (RefSeq) DNA polymerase epsilon subunit 3   KO K02326   DNA polymerase epsilon subunit 3 [EC:2.7.7.7] Organism ccw  Corvus cornix (hooded crow) Pathway ccw03030   DNA replication ccw03082   ATP-dependent chromatin remodeling ccw03410   Base excision repair ccw03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:ccw00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     104688426 (POLE3)    03410 Base excision repair     104688426 (POLE3)    03420 Nucleotide excision repair     104688426 (POLE3)   09126 Chromosome    03082 ATP-dependent chromatin remodeling     104688426 (POLE3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:ccw03032]     104688426 (POLE3)    03036 Chromosome and associated proteins [BR:ccw03036]     104688426 (POLE3)    03400 DNA repair and recombination proteins [BR:ccw03400]     104688426 (POLE3) Enzymes [BR:ccw01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      104688426 (POLE3) DNA replication proteins [BR:ccw03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     104688426 (POLE3) Chromosome and associated proteins [BR:ccw03036]  Eukaryotic type   Chromatin remodeling factors    CHRAC complex     104688426 (POLE3) DNA repair and recombination proteins [BR:ccw03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       104688426 (POLE3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CBFD_NFYB_HMF Histone SpoU_methylase CENP-T_C CIS_TMP BUD22 RNA_pol_3_Rpc31 DUF4746 NOA36 CDC45 Pox_Ag35 PFF1_TM Motif Other DBs NCBI-GeneID:  104688426 NCBI-ProteinID:  XP_039417824 LinkDB All DBs Position 17:complement(9896990..9899430) Genome browser AA seq 143 aa AA seqDB search MAERPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATSCANNFAMKGK RKTLNAGDVLSAMEEMEFQRFVAPLKESLEVYRREQKGKKEARKDKDKKADSEEQDKSRE EDNDDDDERMEEEEQNDEEEVDN NT seq 432 nt NT seq  +upstreamnt  +downstreamnt atggcggagagaccggaggacctgaacctgcccaacgccgtcatcacccgcatcatcaag gaggcgcttcctgatggagtcaatatttccaaagaagcccggagtgcgatctcccgagcg gcgagtgtgtttgtgctgtatgcaacatcatgtgcaaataactttgccatgaaggggaag aggaaaaccctgaatgccggggacgtgctctctgccatggaggagatggagttccagaga ttcgtggcccctctgaaggagtccctggaagtttacaggcgtgagcagaaaggaaagaaa gaggccaggaaagataaagacaagaaggcagactcggaggagcaagataagagccgagag gaggacaatgatgacgatgacgaaaggatggaagaggaagaacaaaacgatgaggaagag gtggacaactga

DBGET integrated database retrieval system