Corvus cornix (hooded crow): 104690479 Help Entry 104690479         CDS       T03546                                  Symbol TXN Name (RefSeq) thioredoxin   KO K03671   thioredoxin Organism ccw  Corvus cornix (hooded crow) Pathway ccw04621   NOD-like receptor signaling pathway ccw05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ccw00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     104690479 (TXN)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     104690479 (TXN)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:ccw03110]     104690479 (TXN) Chaperones and folding catalysts [BR:ccw03110]  Protein folding catalysts   Protein disulfide isomerase    104690479 (TXN) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thioredoxin Thioredoxin_8 Thioredoxin_2 AhpC-TSA DIM1 OST3_OST6 Glutaredoxin Thioredoxin_7 Thioredoxin_9 Redoxin Motif Other DBs NCBI-GeneID:  104690479 NCBI-ProteinID:  XP_039422581 LinkDB All DBs Position Z:44080928..44090309 Genome browser AA seq 105 aa AA seqDB search MVKTVGSLVEFEAELKSAGEKLIVVDFSATWCGPCKMIKPFFHSLCEKYGDVVFIEIDVD DAQDVASHCDVKCMPTFQFYKNGKKVQEFSGANKEKLEETIKSLV NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggtgaagaccgtgggcagcttggttgaatttgaggcagaactgaaatctgctggtgag aagcttatagtagttgatttctctgccacgtggtgtggaccatgcaaaatgatcaagccc tttttccatagtttgtgtgagaagtatggtgatgtggtgttcatagagatcgatgtggat gatgcccaggatgtcgcttcacactgtgatgtgaagtgcatgccaacgttccagttctac aagaacggaaagaaggtgcaggagttctccggggccaataaagagaagctggaagagacc attaaaagtctagtctaa

DBGET integrated database retrieval system