Corvus cornix (hooded crow): 104691091 Help Entry 104691091         CDS       T03546                                  Name (RefSeq) C-C motif chemokine 3   KO K05408   C-C motif chemokine 3 Organism ccw  Corvus cornix (hooded crow) Pathway ccw04060   Cytokine-cytokine receptor interaction ccw04620   Toll-like receptor signaling pathway Brite KEGG Orthology (KO) [BR:ccw00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     104691091  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     104691091  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ccw04052]     104691091    00536 Glycosaminoglycan binding proteins [BR:ccw00536]     104691091 Cytokines and neuropeptides [BR:ccw04052]  Cytokines   Chemokines    104691091 Glycosaminoglycan binding proteins [BR:ccw00536]  Heparan sulfate / Heparin   Chemokines    104691091 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  104691091 NCBI-ProteinID:  XP_010400779 LinkDB All DBs Position 19:5712452..5713414 Genome browser AA seq 91 aa AA seqDB search MKVLAATLATLLLLATCSPSEGHLDGVPSTCCFKYHKMPIPRRLVSSVFVTSSSCTKPGV IVVTKKEKMLCADPQAPWVKELQKHFQSLEN NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgaaagtcctggcagccaccctggccactctgctcctcctggccacctgctccccatct gagggccaccttgatggtgtccccagcacctgctgcttcaaataccataaaatgcccatc cctcggcgcctcgtcagctccgtcttcgtcaccagcagctcctgcaccaagccaggcgtg attgtggtcaccaagaaggagaagatgctgtgtgcagatccacaggcaccatgggtgaag gagctccagaagcacttccagagcctggaaaactga

DBGET integrated database retrieval system