Corvus cornix (hooded crow): 104691739 Help Entry 104691739         CDS       T03546                                  Symbol HRAS Name (RefSeq) GTPase HRas   KO K02833   GTPase HRas Organism ccw  Corvus cornix (hooded crow) Pathway ccw04010   MAPK signaling pathway ccw04012   ErbB signaling pathway ccw04068   FoxO signaling pathway ccw04137   Mitophagy - animal ccw04140   Autophagy - animal ccw04144   Endocytosis ccw04150   mTOR signaling pathway ccw04210   Apoptosis ccw04218   Cellular senescence ccw04370   VEGF signaling pathway ccw04371   Apelin signaling pathway ccw04510   Focal adhesion ccw04540   Gap junction ccw04625   C-type lectin receptor signaling pathway ccw04810   Regulation of actin cytoskeleton ccw04910   Insulin signaling pathway ccw04912   GnRH signaling pathway ccw04916   Melanogenesis ccw05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ccw00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     104691739 (HRAS)    04012 ErbB signaling pathway     104691739 (HRAS)    04370 VEGF signaling pathway     104691739 (HRAS)    04371 Apelin signaling pathway     104691739 (HRAS)    04068 FoxO signaling pathway     104691739 (HRAS)    04150 mTOR signaling pathway     104691739 (HRAS)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     104691739 (HRAS)    04140 Autophagy - animal     104691739 (HRAS)    04137 Mitophagy - animal     104691739 (HRAS)   09143 Cell growth and death    04210 Apoptosis     104691739 (HRAS)    04218 Cellular senescence     104691739 (HRAS)   09144 Cellular community - eukaryotes    04510 Focal adhesion     104691739 (HRAS)    04540 Gap junction     104691739 (HRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     104691739 (HRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     104691739 (HRAS)   09152 Endocrine system    04910 Insulin signaling pathway     104691739 (HRAS)    04912 GnRH signaling pathway     104691739 (HRAS)    04916 Melanogenesis     104691739 (HRAS)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     104691739 (HRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ccw04131]     104691739 (HRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccw04147]     104691739 (HRAS)    04031 GTP-binding proteins [BR:ccw04031]     104691739 (HRAS) Membrane trafficking [BR:ccw04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     104691739 (HRAS)  Endocytosis   Macropinocytosis    Ras GTPases     104691739 (HRAS) Exosome [BR:ccw04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    104691739 (HRAS)   Exosomal proteins of colorectal cancer cells    104691739 (HRAS) GTP-binding proteins [BR:ccw04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     104691739 (HRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 Septin Ldh_1_N AAA_16 Motif Other DBs NCBI-GeneID:  104691739 NCBI-ProteinID:  XP_010401710 LinkDB All DBs Position 5:complement(45390902..45432853) Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVETRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPG CMNCKCVVS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgaatacaagctggtggtggtgggagcaggtggtgttgggaagagtgctttgacg atacagctcattcagaaccattttgttgatgagtatgaccccacgatagaggattcctac agaaagcaagtagtcattgatggagaaacctgtttgttagacatcttggacactgcaggg caggaggagtacagtgccatgagagaccagtacatgagaacgggggaaggattcctgtgt gtctttgccatcaacaacaccaagtcctttgaagatattcaccagtacagggagcagatc aagagggtgaaagactcagatgatgttcccatggtgctggtggggaataaatgtgacctc cctgcccggacagtggagacccggcaagcgcaggacctggcccggagctatgggatcccc tacatagaaacatctgccaaaaccagacagggcgttgaggatgccttctacaccttggtg cgggagatccggcagcataagctgcgcaagctgaatcccccggatgagagcggccccggc tgcatgaactgtaaatgtgtggtatcgtga

DBGET integrated database retrieval system