Corvus cornix (hooded crow): 104692062
Help
Entry
104692062 CDS
T03546
Symbol
FXYD6
Name
(RefSeq) FXYD domain-containing ion transport regulator 6
KO
K13363
FXYD domain-containing ion transport regulator 6
Organism
ccw
Corvus cornix (hooded crow)
Brite
KEGG Orthology (KO) [BR:
ccw00001
]
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
ccw02000
]
104692062 (FXYD6)
Transporters [BR:
ccw02000
]
Other transporters
Pores ion channels [TC:
1
]
104692062 (FXYD6)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ATP1G1_PLM_MAT8
Glycophorin_A
EphA2_TM
Motif
Other DBs
NCBI-GeneID:
104692062
NCBI-ProteinID:
XP_039420900
LinkDB
All DBs
Position
24:complement(1086157..1096246)
Genome browser
AA seq
96 aa
AA seq
DB search
MEAALIFLCSLLVPAAVADVATQEKEEEDPFNYDYQSLRIGGLVFAVVLFTVGILLILSR
RCRCSFKQKPRAPGDEEAQAENLITSNATAAQKAEN
NT seq
291 nt
NT seq
+upstream
nt +downstream
nt
atggaggcagcactcatcttcctgtgctccctgctggtgccagcggccgtggcagacgtg
gccacccaggagaaggaggaggaggatccctttaactacgattaccagagcctgaggatc
ggggggctggtgtttgccgtggtcctgttcaccgtgggcattctcctcatactcagcagg
aggtgcaggtgcagtttcaagcagaagcccagggctccaggggacgaggaggctcaggcg
gagaacctgatcacctcgaacgcgacggcggcacagaaagcagagaactga
DBGET
integrated database retrieval system