KEGG   Corvus cornix (hooded crow): 104692474
Entry
104692474         CDS       T03546                                 
Symbol
TIMM17A
Name
(RefSeq) mitochondrial import inner membrane translocase subunit Tim17-A
  KO
K17795  mitochondrial import inner membrane translocase subunit TIM17
Organism
ccw  Corvus cornix (hooded crow)
Brite
KEGG Orthology (KO) [BR:ccw00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ccw03029]
    104692474 (TIMM17A)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ccw02000]
    104692474 (TIMM17A)
Mitochondrial biogenesis [BR:ccw03029]
 Mitochondrial protein import machinery
  Inner mambrane
   TIM23 complex
    104692474 (TIMM17A)
Transporters [BR:ccw02000]
 Other transporters
  Primary active transporters [TC:3]
   104692474 (TIMM17A)
SSDB
Motif
Pfam: Tim17
Other DBs
NCBI-GeneID: 104692474
NCBI-ProteinID: XP_039421209
LinkDB
Position
26:complement(6467566..6477764)
AA seq 166 aa
MEEYAREPCPWRIVDDCGGAFTMGAIGGGIFQAIKGFRNSPVGVNHRLRGSLTAIKTRAP
QLGGSFAVWGGLFSMIDCSMVRMRGKEDPWNSITSGALTGAILAARNGPVAMVGSAAMGG
ILLALIEGAGILLTRFASTQFPNGPQLSEDPSQLQPPPFSDYRQYQ
NT seq 501 nt   +upstreamnt  +downstreamnt
atggaggagtacgcgcgcgagccctgtccctggaggatagtggatgactgcggaggggcc
ttcaccatgggggccataggagggggcattttccaggctatcaaaggcttccgaaattcc
ccagtgggtgtcaaccaccggctgcgtggcagtttgacagccattaaaaccagagctcca
caactgggagggagttttgctgtctggggaggtctcttctccatgattgactgcagtatg
gtcaggatgagagggaaggaagatccctggaattccatcacgagcggagccctgactgga
gccattttggctgcaagaaatggccctgttgccatggtcggatctgctgcgatgggagga
attctcctggccttgatcgaaggagcaggaattctgctgacaagatttgcctccacacag
ttcccaaacggcccacagttgtcagaggatccatcccagctccagccacccccgttcagc
gactaccgacagtaccagtga

DBGET integrated database retrieval system