KEGG   Corvus cornix (hooded crow): 104693189
Entry
104693189         CDS       T03546                                 
Symbol
CCNH
Name
(RefSeq) cyclin-H
  KO
K06634  cyclin H
Organism
ccw  Corvus cornix (hooded crow)
Pathway
ccw03022  Basal transcription factors
ccw03420  Nucleotide excision repair
ccw04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:ccw00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    104693189 (CCNH)
  09124 Replication and repair
   03420 Nucleotide excision repair
    104693189 (CCNH)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104693189 (CCNH)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ccw03021]
    104693189 (CCNH)
   03400 DNA repair and recombination proteins [BR:ccw03400]
    104693189 (CCNH)
Transcription machinery [BR:ccw03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     104693189 (CCNH)
DNA repair and recombination proteins [BR:ccw03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     104693189 (CCNH)
SSDB
Motif
Pfam: Cyclin_C_2 Cyclin_N RE_NgoPII Legum_prodom CycT2-like_C
Other DBs
NCBI-GeneID: 104693189
NCBI-ProteinID: XP_039423109
LinkDB
Position
Z:complement(71721473..71750604)
AA seq 325 aa
MFHSSTQRRHWTFRGGEELARRRAEGNRRARARAAASGKVPQGDPVLLEPHEELALCKYY
EKRLLDFCAAFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNV
SSAQFVGNLRESPLGQEKALEQILEYELLLIQELNFHLIIHNPYRPFEGFLIDIKTRYPV
LENPEVLRKTADDFLNRVALTDAYLLFTPSQIALTAILSSGSRAGINMESYLSESLMLKE
NRSTLSRLLDDMKCMKNLIKRYELPRPEEVAALKQKLEKCHSLELSFNTNLKKRKGYEDD
EYVTKKCKMDEEEWTDDDLVDSALL
NT seq 978 nt   +upstreamnt  +downstreamnt
atgttccacagcagcacgcagcgccggcactggacctttcgcggcggggaggaactggcg
cggcgccgcgccgaggggaaccgccgggcccgggccagggcggcggccagcgggaaggtg
ccgcagggcgacccggtgctgctggagccgcacgaggagctggcgctatgcaagtactac
gagaagcggctgctggacttctgcgccgcgttcaagccggcgatgccgcggtccgttgtg
ggaacagcttgcatgtatttcaaacgtttttacctcaataactcagtgatggagtatcat
cctcggataataatgctgacatgtgcatttttggcctgtaaagtagatgaatttaatgta
tccagtgcacagtttgttggtaaccttcgagaaagtcctcttggacaggaaaaagctctt
gaacaaatactggaatatgaactgctacttattcaggaactgaacttccatcttatcatc
cacaatccatacaggccatttgagggatttctaattgatattaagactcgctatccagtg
ctggaaaatcctgaagttctgaggaaaacagctgatgacttccttaatcgagtggctctg
acagatgcgtatctgctctttacgccctcacagatagctctcactgccatattatctagt
ggctcaagagcaggaattaatatggagagctatttatcagaaagtctgatgctgaaagaa
aacagatcaaccttatccagattactagatgacatgaaatgcatgaaaaatctcataaaa
cgatatgaactgccgaggcctgaagaggttgctgctctaaaacagaagttagagaagtgt
cacagtttggagctttcatttaatacaaacctgaagaagaggaaaggctatgaagatgat
gaatatgtcacaaagaaatgtaaaatggatgaggaagagtggactgatgatgatcttgtg
gattcagcattactttga

DBGET integrated database retrieval system