Corvus cornix (hooded crow): 104693346 Help Entry 104693346         CDS       T03546                                  Symbol CENPS Name (RefSeq) centromere protein S   KO K11511   centromere protein S Organism ccw  Corvus cornix (hooded crow) Pathway ccw03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:ccw00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     104693346 (CENPS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ccw03036]     104693346 (CENPS)    03400 DNA repair and recombination proteins [BR:ccw03400]     104693346 (CENPS) Chromosome and associated proteins [BR:ccw03036]  Eukaryotic type   Centromeric chromatin formation proteins    Kinetochore proteins     Centromere proteins      104693346 (CENPS) DNA repair and recombination proteins [BR:ccw03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      104693346 (CENPS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-S CENP-T_C DASH_Dad2 DUF1601 Histone Motif Other DBs NCBI-GeneID:  104693346 NCBI-ProteinID:  XP_039419741 LinkDB All DBs Position 21:6424374..6427117 Genome browser AA seq 149 aa AA seqDB search MAAGAALGGEEQQLLTQRLKAAVHYTVGCLCQEVEEDKDVQFSKQSIAAIAEITFGQCGT AALPEIFAKDLEMFARHAKRTTVNTEDVKLLARRSNSLLKYITQKSEELASSNMEQKEKK KKKSSAAKGGRTPGEQEAAVTENEDSSMA NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggcggcgggggcggcgctcggcggcgaggagcagcagctgctcacacagaggctgaag gcggcggttcactacacggtggggtgcctgtgccaggaggtggaggaggacaaggacgtg cagttcagcaaacagagcatagcggccatcgcagagatcaccttcgggcagtgcggtaca gctgcgttacctgaaatctttgcaaaagacctggaaatgtttgcaaggcatgcaaaacga accacagtcaacacagaagatgtgaagcttttggctagaagaagcaattctctgctaaaa tatatcactcagaagagtgaagagcttgcatcaagtaacatggagcagaaggagaagaag aaaaagaagtccagtgcagctaagggagggagaactcctggggaacaagaagcagctgtg actgaaaatgaagattccagcatggcatga

DBGET integrated database retrieval system