Corvus cornix (hooded crow): 104693439 Help Entry 104693439         CDS       T03546                                  Symbol CCL20 Name (RefSeq) C-C motif chemokine 20   KO K14625   C-C motif chemokine 20 Organism ccw  Corvus cornix (hooded crow) Pathway ccw04060   Cytokine-cytokine receptor interaction Brite KEGG Orthology (KO) [BR:ccw00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     104693439 (CCL20)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ccw04052]     104693439 (CCL20) Cytokines and neuropeptides [BR:ccw04052]  Cytokines   Chemokines    104693439 (CCL20) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 FSAP_sig_propep Motif Other DBs NCBI-GeneID:  104693439 NCBI-ProteinID:  XP_010404375 LinkDB All DBs Position 9:complement(15942680..15949589) Genome browser AA seq 100 aa AA seqDB search MIGCSSKSMVLVFLLGLLVLLLCGTSEAQSNQDCCLSYTKVRLPRWALKGYTEQLSSEVC DIPAIIFHTSSGLKACVNPKEGWVKKHLLFLSHKLRKMSA NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgattggctgcagcagcaagagcatggtcctggttttcctgctggggctcctggtgctg ctcctgtgcggcacctccgaagcacaaagcaaccaggattgttgcctgtcttacaccaaa gtgcgtctgcctcggtgggccctgaagggttacactgaacagctctccagtgaggtctgt gacatccctgccatcattttccacacctccagtgggctgaaggcctgtgtaaatcctaag gaaggctgggtcaagaaacatcttcttttcctgagccacaagctcaggaagatgtcagcc tga

DBGET integrated database retrieval system