Corvus cornix (hooded crow): 104695123
Help
Entry
104695123 CDS
T03546
Symbol
DIRAS3
Name
(RefSeq) GTP-binding protein Di-Ras3
KO
K07841
DIRAS family, GTP-binding Ras-like 2
Organism
ccw
Corvus cornix (hooded crow)
Brite
KEGG Orthology (KO) [BR:
ccw00001
]
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
04031 GTP-binding proteins [BR:
ccw04031
]
104695123 (DIRAS3)
GTP-binding proteins [BR:
ccw04031
]
Small (monomeric) G-proteins
Ras Family
Di-Ras [OT]
104695123 (DIRAS3)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Ras
Roc
Arf
RsgA_GTPase
MMR_HSR1
GTP_EFTU
MeaB
AAA_24
AAA_16
nSTAND1
SRPRB
MMR_HSR1_Xtn
AAA_22
NACHT
ATPase_2
Motif
Other DBs
NCBI-GeneID:
104695123
NCBI-ProteinID:
XP_010407013
LinkDB
All DBs
Position
8:1141236..1142810
Genome browser
AA seq
198 aa
AA seq
DB search
MPEQSNDYRVVVFGAAGVGKSSLVLRFVRGTFRETYIPTIEDTYRQVISCDKSICTLQIT
DTTGSHQFPAMQRLSISKGHAFILVYSVTSRQSMEDLHPIFDEICQIKGDIQKIPIMLVG
NKSDDTQRELDASEGQALASKWKCAFMETSAKMNYNVQELFQELLNLEQRRTISLQVDGK
KSKQQKKKDKLQGKCSVM
NT seq
597 nt
NT seq
+upstream
nt +downstream
nt
atgcctgagcagagcaatgattacagggtggtggtgttcggagcagcgggggtcggcaaa
agctccctagtcctgcgctttgtaaggggcactttcagggaaacctatatccccaccatc
gaggatacgtaccggcaggtgatcagctgtgacaagagcatctgcaccctgcagatcacg
gacaccacgggcagccatcagttccctgccatgcagcggctgtccatatccaaagggcat
gccttcatcttggtgtactccgtcaccagcaggcaatccatggaagatcttcaccccatc
ttcgatgagatttgtcagattaaaggcgacatccagaaaatcccgataatgttggtgggg
aacaaaagcgacgacacgcagagggagctggatgccagcgaggggcaagcgctggccagc
aagtggaaatgtgccttcatggagacgtcagccaaaatgaactacaacgtgcaggagctc
ttccaggagctcttgaatctggagcagaggagaactatcagtctccaggtggatggaaag
aaatccaaacagcagaaaaagaaagataaactgcaaggcaaatgctctgttatgtga
DBGET
integrated database retrieval system