Corvus cornix (hooded crow): 104695784 Help Entry 104695784         CDS       T03546                                  Name (RefSeq) C-C motif chemokine 4 homolog   KO K12964   C-C motif chemokine 4 Organism ccw  Corvus cornix (hooded crow) Pathway ccw04060   Cytokine-cytokine receptor interaction ccw04620   Toll-like receptor signaling pathway ccw04623   Cytosolic DNA-sensing pathway Brite KEGG Orthology (KO) [BR:ccw00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     104695784  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     104695784    04623 Cytosolic DNA-sensing pathway     104695784  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ccw04052]     104695784 Cytokines and neuropeptides [BR:ccw04052]  Cytokines   Chemokines    104695784 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  104695784 NCBI-ProteinID:  XP_010408096 LinkDB All DBs Position 19:301529..303199 Genome browser AA seq 90 aa AA seqDB search MKVSAAGLALLLISASFSQTFSGPAGSDLPICCVKYTQHKLPWKRIQRHYITSSSCPLTA VVFVTKEGRQVCANPENTWVQRHLQILEQN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaaggtctctgcagctggattggctcttctcctcatttcagcctccttctcccagact ttctctggtccagctggatctgacctcccaatctgctgtgtcaaatatacacagcacaag ctcccatggaagcgcatccagcgtcattatatcaccagcagcagttgtcccctgacggct gtcgtgtttgtcacaaaggaaggccgccaggtctgtgccaatcccgaaaacacctgggtc caaagacacctgcaaatcttggagcagaactga

DBGET integrated database retrieval system