Corvus cornix (hooded crow): 104696400 Help Entry 104696400         CDS       T03546                                  Name (RefSeq) histone H2A   KO K11251   histone H2A Organism ccw  Corvus cornix (hooded crow) Pathway ccw03082   ATP-dependent chromatin remodeling ccw04217   Necroptosis Brite KEGG Orthology (KO) [BR:ccw00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     104696400  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     104696400  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ccw03036]     104696400   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccw04147]     104696400 Chromosome and associated proteins [BR:ccw03036]  Eukaryotic type   Nucleosome assembly factors    Histones     104696400 Exosome [BR:ccw04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    104696400 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  104696400 NCBI-ProteinID:  XP_010409021 LinkDB All DBs Position 1A:47289266..47289956 Genome browser AA seq 129 aa AA seqDB search MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK TDSHKAKSK NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgtccggccggggcaagcagggcgggaaggcgcgcgccaaggccaagtcgcgctcgtcg cgggccgggctgcagttccccgtgggccgcgtgcaccggctgctgcgcaagggcaactac gcggagcgcgtgggcgccggcgccccggtgtacctggcggccgtgctggagtacctgacg gccgagatcctggagctggcgggcaacgcggcccgcgacaacaagaagacgcgcatcatc ccccgccacctgcagctcgccatccgcaacgacgaggagctcaacaagctgctgggcaag gtgacgatcgcgcagggcggcgtgctgcccaacatccaggccgtgctgctgcccaagaag accgacagccacaaggcaaaaagcaagtga

DBGET integrated database retrieval system