KEGG   Corvus cornix (hooded crow): 109143195
Entry
109143195         CDS       T03546                                 
Name
(RefSeq) melanocortin-2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
ccw  Corvus cornix (hooded crow)
SSDB
Motif
Pfam: MRAP PAG SelK_SelG
Other DBs
NCBI-GeneID: 109143195
NCBI-ProteinID: XP_039421743
LinkDB
Position
1:922343..930063
AA seq 91 aa
MANRTNSSEYFWSYEYYWDYIDPIPVDGSKLKVNKYSIVIAFWVGLAAFVMFLFLILLCM
SCSGSTPANTATNGSAGSGRSSLGSDCARAN
NT seq 276 nt   +upstreamnt  +downstreamnt
atggctaacagaacaaactcctctgagtatttctggtcttatgaatattactgggattac
atagatccaattccagtagatggaagcaagttgaaggttaataaatactccatcgtcatt
gccttttgggtcggccttgctgcatttgtgatgtttcttttccttattttactgtgtatg
tcctgctctggatcaaccccagcaaacacggctacgaacggcagtgcagggtcgggcagg
agttcattaggcagtgactgcgctcgcgctaattaa

DBGET integrated database retrieval system