Corvus cornix (hooded crow): 120410085 Help Entry 120410085         CDS       T03546                                  Symbol POLD4 Name (RefSeq) DNA polymerase delta subunit 4   KO K03505   DNA polymerase delta subunit 4 Organism ccw  Corvus cornix (hooded crow) Pathway ccw03030   DNA replication ccw03410   Base excision repair ccw03420   Nucleotide excision repair ccw03430   Mismatch repair ccw03440   Homologous recombination Brite KEGG Orthology (KO) [BR:ccw00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     120410085 (POLD4)    03410 Base excision repair     120410085 (POLD4)    03420 Nucleotide excision repair     120410085 (POLD4)    03430 Mismatch repair     120410085 (POLD4)    03440 Homologous recombination     120410085 (POLD4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:ccw03032]     120410085 (POLD4)    03400 DNA repair and recombination proteins [BR:ccw03400]     120410085 (POLD4) DNA replication proteins [BR:ccw03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase delta complex     120410085 (POLD4) DNA repair and recombination proteins [BR:ccw03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase delta complex       120410085 (POLD4)    MMR (mismatch excision repair)     DNA polymerase delta complex      120410085 (POLD4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_pol_delta_4 Motif Other DBs NCBI-GeneID:  120410085 NCBI-ProteinID:  XP_039408834 LinkDB All DBs Position 5:58959912..58961091 Genome browser AA seq 126 aa AA seqDB search MSRRAMEQPRRITDSFPRRRRRGPGRPPGRLKDKKDKDKVQVKVKVQVRDCPSAPSQPPV DPALLEMLRRFDLSWEYGPCTGITRLQRWERAQELGLSPPGPIRDALLEHRDNPDVTYSL WHEYEL NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgtcgcgcagggccatggagcagccccggcgcatcaccgactccttcccgcggcggcgg cggcggggccccgggcggcccccgggcaggctcaaggacaagaaggacaaggacaaagtg caggtgaaggtgaaggtgcaggtgcgggactgtcccagcgccccctcgcagccccccgtg gacccggcgctcctggagatgctgcggcgcttcgacctctcctgggaatacggaccctgc accgggatcacccgcctgcagcgctgggagcgggcacaagagctggggctgagccccccc ggccccatccgtgacgcccttctggagcaccgggacaaccccgacgtcacctacagcctc tggcacgagtacgagctctga

DBGET integrated database retrieval system