Corvus cornix (hooded crow): 120410202 Help Entry 120410202         CDS       T03546                                  Symbol BBIP1 Name (RefSeq) BBSome-interacting protein 1   KO K19399   BBSome-interacting protein 1 Organism ccw  Corvus cornix (hooded crow) Brite KEGG Orthology (KO) [BR:ccw00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:ccw03037]     120410202 (BBIP1) Cilium and associated proteins [BR:ccw03037]  Primary cilia and associated proteins   BBSome    120410202 (BBIP1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  BBIP10 Motif Other DBs NCBI-GeneID:  120410202 NCBI-ProteinID:  XP_039409829 LinkDB All DBs Position 6:9715231..9716535 Genome browser AA seq 67 aa AA seqDB search MPEGTGALREVLPKQGQLSVEDTAAMVLCKPKILPLKSVSLEKLEKLQRAALEAAPPPSA GAAPPRQ NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atgccggaggggacgggagcgctccgggaggtgctgcccaagcaagggcagctgtcggtg gaggacacggccgccatggtgctgtgcaagcccaagatcctgcccctcaagtcggtgtcg ctggagaagctggagaagctgcagcgggcggcgctggaggcggccccgccgccgtccgcg ggggccgcaccgcctcggcagtag

DBGET integrated database retrieval system