Corvus cornix (hooded crow): 120410692 Help Entry 120410692         CDS       T03546                                  Symbol BRK1 Name (RefSeq) protein BRICK1   KO K05752   chromosome 3 open reading frame 10 Organism ccw  Corvus cornix (hooded crow) Pathway ccw04810   Regulation of actin cytoskeleton ccw05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ccw00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     120410692 (BRK1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     120410692 (BRK1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CCDC53 Hydro_N_hd DUF7310 SPX Matrilin_ccoil MerR-DNA-bind LXG Motif Other DBs NCBI-GeneID:  120410692 NCBI-ProteinID:  XP_039415222 LinkDB All DBs Position 12:6603343..6605794 Genome browser AA seq 75 aa AA seqDB search MSVQEDPVQREIHQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERR IEYIEARVTKGETLT NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgtcggtgcaggaggacccggtgcagcgggagatccaccaggactgggccaaccgcgag tacatcgaggtgatcaccagctccatcaagaagatcgcggacttcctcaactccttcgac atgtcgtgccggtcccggctggccaccctgaacgagaagctgactgcgctggagcggaga atcgagtacatcgaggcccgggtcaccaagggggagacgctgacatag

DBGET integrated database retrieval system