Corvus cornix (hooded crow): 120411985 Help Entry 120411985         CDS       T03546                                  Name (RefSeq) histone H2A type 2-C   KO K11251   histone H2A Organism ccw  Corvus cornix (hooded crow) Pathway ccw03082   ATP-dependent chromatin remodeling ccw04217   Necroptosis Brite KEGG Orthology (KO) [BR:ccw00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     120411985  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     120411985  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ccw03036]     120411985   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccw04147]     120411985 Chromosome and associated proteins [BR:ccw03036]  Eukaryotic type   Nucleosome assembly factors    Histones     120411985 Exosome [BR:ccw04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    120411985 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  120411985 NCBI-ProteinID:  XP_039427590 LinkDB All DBs Position 1A:complement(47371534..47372034) Genome browser AA seq 129 aa AA seqDB search MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK TESHKAKSK NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgtccggccggggcaagcagggcgggaaggcgcgcgccaaggccaagtcgcgctcgtcg cgggccgggctgcagttccccgtgggccgcgtgcaccggctgctgcgcaagggcaactac gcggagcgcgtgggcgccggcgccccggtgtacctggcggccgtgctggagtacctgacg gccgagatcctggagctggcgggcaacgcggcccgcgacaacaagaagacgcgcatcatc ccccgccacctgcagctcgccatccgcaacgacgaggagctcaacaagctgctgggcaag gtgacgatcgcgcagggcggcgtgctgcccaacatccaggctgtgctgctgcccaagaag actgagagccacaaagccaagagcaagtaa

DBGET integrated database retrieval system