Corvus cornix (hooded crow): 71712354 Help Entry 71712354          CDS       T03546                                  Symbol ND4L, MW377_mgp12 Name (RefSeq) NADH dehydrogenase subunit 4L   KO K03882   NADH-ubiquinone oxidoreductase chain 4L [EC:7.1.1.2] Organism ccw  Corvus cornix (hooded crow) Pathway ccw00190   Oxidative phosphorylation ccw01100   Metabolic pathways Module ccw_M00142   NADH:ubiquinone oxidoreductase, mitochondria Brite KEGG Orthology (KO) [BR:ccw00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     71712354 (ND4L)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:ccw03029]     71712354 (ND4L) Enzymes [BR:ccw01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      71712354 (ND4L) Mitochondrial biogenesis [BR:ccw03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA-encoded proteins    Mitochondrial respiratory chain complex I     71712354 (ND4L) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Oxidored_q2 DUF4094 Motif Other DBs NCBI-GeneID:  71712354 NCBI-ProteinID:  YP_010329995 LinkDB All DBs Position MT:1220..1516 Genome browser AA seq 98 aa AA seqDB search MSALQLSFFSAFTLSSLGLAFHRTHLISALLCLESMMLSMYIALSMWPIQTQTTSATLLP LLMLAFSACEAATGLALLVASTRTHGSDHLHNFNLLQC NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgtctgccctacaattaagctttttctccgctttcaccctaagcagcctaggcctagcc ttccaccgcacacacttaatctctgccctactatgtctggaaagcatgatattatccata tacatcgccctttccatatgacccatccaaacccaaacaacatccgctaccctcctgccg cttctcatattagcattttccgcctgcgaagcagcaacaggcctagccctgctagttgct tcaactcggacccacggctccgaccacctacacaactttaacctactacaatgctaa

DBGET integrated database retrieval system