Corallococcus coralloides: COCOR_01336 Help Entry COCOR_01336       CDS       T01780                                  Symbol hup Name (GenBank) DNA-binding protein HU   KO K03530   DNA-binding protein HU-beta Organism ccx  Corallococcus coralloides Brite KEGG Orthology (KO) [BR:ccx00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:ccx03032]     COCOR_01336 (hup)    03036 Chromosome and associated proteins [BR:ccx03036]     COCOR_01336 (hup)    03400 DNA repair and recombination proteins [BR:ccx03400]     COCOR_01336 (hup) DNA replication proteins [BR:ccx03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     COCOR_01336 (hup) Chromosome and associated proteins [BR:ccx03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     COCOR_01336 (hup) DNA repair and recombination proteins [BR:ccx03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       COCOR_01336 (hup) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG MetW SpoIIIAH HARE-HTH Motif Other DBs NCBI-ProteinID:  AFE09103 UniProt:  H8MTL0 LinkDB All DBs Position complement(1618108..1618377) Genome browser AA seq 89 aa AA seqDB search MTKAELVEVVAAQSKLTKKQAAQILDSVFTNIGKAVKKDTRFSYPGFGTWSLRSRKARKI RNPQTNEMMKLKASKTVGFRPAKELKNSL NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgaccaaggcagagctcgtggaagtggtggctgcgcagtcgaagctcacgaagaagcag gccgcccagatcctcgacagcgtcttcaccaacatcggcaaggcggtgaagaaggacacc cgcttcagctaccccgggttcggcacgtggtcgctgcgttcgcgcaaggcgcggaagatc cgcaacccgcagaccaacgagatgatgaagctgaaggcgtcgaagacggtcggtttccgt ccggccaaggagctgaagaactcgctgtag

DBGET integrated database retrieval system