Corallococcus coralloides: COCOR_05852 Help Entry COCOR_05852       CDS       T01780                                  Name (GenBank) putative acyl carrier protein   KO K02078   acyl carrier protein Organism ccx  Corallococcus coralloides Pathway ccx01100   Metabolic pathways ccx01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ccx00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     COCOR_05852    00074 Mycolic acid biosynthesis     COCOR_05852   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     COCOR_05852 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7108_C Motif Other DBs NCBI-ProteinID:  AFE06617 UniProt:  H8MH19 LinkDB All DBs Position 7388225..7388488 Genome browser AA seq 87 aa AA seqDB search MLELEQEIKRLVIDTLNLEDLKPDDIDPAAPLFVEGLGLDSIDALELGLALQKSYGVVLA SDSKENRRHFASVRALADFVSTHRTRS NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgttggagcttgagcaggaaataaagcggctggtcatcgacacgttgaacctcgaggac ctcaagccggacgacatcgatccggcggcgccgctgttcgtcgaagggctggggctggac tccatcgacgccctcgagctcggcctcgcgttgcagaagtcctatggcgtcgtgctggcg agcgactccaaggagaatcgccgccacttcgcaagtgttcgggcgctcgcggacttcgtc agcacccaccgcacccgttcctaa

DBGET integrated database retrieval system