Corallococcus coralloides: COCOR_05853 Help Entry COCOR_05853       CDS       T01780                                  Symbol acpP1 Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ccx  Corallococcus coralloides Pathway ccx01100   Metabolic pathways ccx01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ccx00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     COCOR_05853 (acpP1)    00074 Mycolic acid biosynthesis     COCOR_05853 (acpP1)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     COCOR_05853 (acpP1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  AFE07958 UniProt:  H8MH20 LinkDB All DBs Position 7388525..7388785 Genome browser AA seq 86 aa AA seqDB search MTKHELFERLSAILQETFDIEPARIVPEARLHDDLDIDSIDAIDLLVRLKPVTGQRVPPE VFRSVRTIQDVVDALYGLLGSDSAAA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgaccaagcacgagctgttcgagcgcctgagcgccatcctccaggaaaccttcgacatc gagccggcccgcatcgtcccggaggcgcggctgcacgacgacctcgacatcgacagcatt gacgccatcgacctgctggtgcgcctgaagccggtgacgggccagcgcgttccgccggaa gtcttccgctccgtgcgcaccatccaggacgtggtggacgcgctgtacggtctgctcggc agcgactccgccgcggcgtga

DBGET integrated database retrieval system