Corallococcus coralloides: COCOR_07207 Help Entry COCOR_07207       CDS       T01780                                  Symbol acp Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ccx  Corallococcus coralloides Pathway ccx01100   Metabolic pathways ccx01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ccx00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     COCOR_07207 (acp)    00074 Mycolic acid biosynthesis     COCOR_07207 (acp)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     COCOR_07207 (acp) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AFE07956 UniProt:  H8MIL9 LinkDB All DBs Position complement(9047424..9047699) Genome browser AA seq 91 aa AA seqDB search MADIVTEAVAEIRRIVREELEFEGAVEPSHDLLRDLQLDSLGLTVLAVGLENRFRVLLSE EDAQGVRTVEDLARLVAARVEAAKPDVGAHP NT seq 276 nt NT seq  +upstreamnt  +downstreamnt gtggctgacatcgtgacggaggcggtggcggagatccgccgcattgtccgggaggagctg gagttcgagggcgcggtggagccctcgcacgacctgctccgggacctgcagctggacagc ctggggctgacggtgctggcggtggggctggagaaccgcttccgggtgctgctgtcggag gaggacgcgcagggcgtgcggacggtggaggacctggcgcggctggtggcggcgcgggtc gaggccgcgaagccggacgtgggagcgcacccgtga

DBGET integrated database retrieval system